KEGG   Bos taurus (cow): 530001Help
Entry
530001            CDS       T01008                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
bta  Bos taurus (cow)
Pathway
Inositol phosphate metabolism
cGMP-PKG signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Platelet activation
Cholinergic synapse
Oxytocin signaling pathway
Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    530001 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    530001 (PIK3CG)
   04072 Phospholipase D signaling pathway
    530001 (PIK3CG)
   04022 cGMP - PKG signaling pathway
    530001 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    530001 (PIK3CG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    530001 (PIK3CG)
  Endocrine system
   04921 Oxytocin signaling pathway
    530001 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    530001 (PIK3CG)
  Nervous system
   04725 Cholinergic synapse
    530001 (PIK3CG)
 Human Diseases
  Infectious diseases
   05145 Toxoplasmosis
    530001 (PIK3CG)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     530001 (PIK3CG)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    530001 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
4
AA seq 885 aa AA seqDB search
MELENHEQPVVLREDNCRRRRRMKPRSTAASMSSMELIPIEFVLPTSQRNTKTPETALLH
VAGHGNVEQMKAQVWLRVLETSVAADFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLHYWKVLHRSPGQIHLVQRHSPSEETLAFQRQLTALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDPKLYAMHPWVTSKPLPEYLLKKITNNCIFIIIHRSTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLMDIPESQNEQDFVLRVCGRDEYLVGETPIKNFQWVRQCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQYGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSGKASAETPSPESRGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQLSGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKDPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLRDFTQQVQVIDMLQKVTIDIKSLSAEKYDVSSQVIFQLKQKLEILQNLNLP
QSFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGNHQHEPGK
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaaccatgaacagcctgtggtgctgagagaggacaactgccgcaggcgc
cggaggatgaagccacgcagcacggcggccagcatgtcctccatggagctcatccccatt
gagttcgtgctgcccaccagccaacgcaacaccaagacccccgaaacggcgctgctgcac
gtggccggccacggcaacgtggagcagatgaaggcccaagtgtggctgcgcgtgctggag
accagcgtggccgccgacttctaccacaggctgggcccggaccacttcctcctgctctac
cagaagaaggggcagtggtatgagatctatgacaagtaccaggtggtgcagaccctggac
tgcctgcactactggaaggtgctgcaccggagccccgggcagatccacctggtacagcgg
cactcgccctcagaggagacgctggccttccagcgccagctcactgccctcatcggctac
gatgtcacagatgtcagcaatgtgcacgacgacgagttggagttcacacgccgccgcctg
gtcaccccgcgtatggccgaggtggctggccgcgaccccaagctctacgccatgcacccc
tgggtgacgtctaagcccctccctgagtacctgctgaagaagatcaccaacaactgtatc
ttcatcattattcaccgcagcaccaccagccagaccatcaaggtctcggctgatgatacc
cctggcaccatcctccagagcttctttaccaaaatggccaagaagaagtccctgatggat
atccccgagagccagaacgaacaggactttgtgctgcgtgtctgtggccgcgatgagtac
ctggtgggcgagacgcccatcaaaaactttcagtgggtgcggcagtgccttaagaatggt
gaagagattcacctggtgcttgacactccgccggacccagccctggatgaggtgaggaag
gaagagtggccgctggtggatgactgcactggagtcactggctaccatgagcagctaacc
atccatgggaaggaccatgagagcgtgttcactgtgtccctgtgggactgtgaccgcaag
ttcagagtcaagatcaggggcatcgatatccccgtcctgccccggaatgcagatctcacg
gtttttgtggaggcaaacatccagtatgggcagcaagtcctttgccaaagaagaaccagc
ccaaaacccttcacggaggaggtgctctggaatgtgtggcttgagttcagtatcaagatc
aaagacttacccaaaggggctctgctcaacctccagatctactgtggcaaagcaccagct
ctgtctggtaaggcctctgcagagactcccagtcccgagtccagaggcaaagctcagctt
ctctactacgtgaacttgctgctcatcgaccaccgattcctcctgcgccacggcgagtac
gtgctccacatgtggcagttatctgggaagggggaagaccaagggagcttcaatgcagac
aagctcacatctgccaccaatcccgacaaggaaaactcaatgtccatctccattctcctg
gacaactactgtcaccccatagccttgcctaagcatcagcccacccctgacccggaaggg
gaccgcgtacgagcagaaatgcccaaccaacttcggaagcaactggaggcaatcatagct
actgatccacttaaccctcttactgcggaagacaaagaattgctttggcatttcagatat
gaaagccttaaggatcccaaagcataccctaagctctttagctcagtgaaatggggacag
caagaaattgtggccaaaacatatcaattgttagccagaagggaggtctgggatcaaagt
gctttggatgttggattaacgatgcaactcctagactgcaacttttcggatgaaaacgta
agagccattgcagttcagaaactggagagcttggaagacgatgacgttctgcattacctg
ctccaattggtccaggctgtgaaatttgaaccataccatgacagtgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcacttcttgttttggttcttgaga
agtgagattgcccagtcgagacactatcagcagaggtttgcagtgatcctggaggcctac
ctgaggggctgtggtacggccatgctacgggacttcactcaacaagtccaagtaattgac
atgttacaaaaagtcaccattgatattaaatcactctctgccgaaaagtatgacgtcagc
tcccaagttattttccaactaaagcaaaagcttgaaatcctgcagaatttgaatctcccc
caaagctttagagttccatatgaccctggactgaaggcaggcgcactggtgattgaaaaa
tgtaaagtgatggcctctaagaaaaaacctctgtggcttgagtttaaatgtgctgaccct
acagctctatcaaatgaaacaattggaattatctttaaacacggtgatgatctgcgccaa
gacatgcttattctacagattctacgaatcatggagtccatttgggagactgaatctttg
gatctgtgcctcctgccatatggttgcatttcaactggtgacaaaataggaaaccaccag
cacgaacctggaaaataa

DBGET integrated database retrieval system