KEGG   Bos taurus (cow): 530553Help
Entry
530553            CDS       T01008                                 

Definition
UDP-glucuronosyltransferase 2C1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
bta  Bos taurus (cow)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    530553
   00053 Ascorbate and aldarate metabolism
    530553
   00500 Starch and sucrose metabolism
    530553
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    530553
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    530553
   00860 Porphyrin and chlorophyll metabolism
    530553
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    530553
   00982 Drug metabolism - cytochrome P450
    530553
   00983 Drug metabolism - other enzymes
    530553
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    530553
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     530553
Glycosyltransferases [BR:bta01003]
 Others
  Hydrophobic molecule
   530553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
6
AA seq 529 aa AA seqDB search
MKTVKGFCILFMLHLCLLDSGRMGKVLVWPVDFSHWINLQFILEELHIHGHEITVLVPSQ
NLLIDHTKVPYHVEILQLSVTEETFMEEFNSMLYEEIFELPKLSWWEMQIKLADLVKKFL
LTNKRVCDSAITNKELLSRLQAANFDVCIADPLSFCGELVAELLNIPFVYTFRFFYGNAI
ERLCAGLPMPSSYVPGVTSRLTDKMTFRQRLENWLLYTVSDMIYSYYIFPEWDEYYSKVL
GKPTTLCEIMGKADMWLFRSYWDFEFPQPYLPNTEFVGGLHCKPAKPLPKEFEEFVQSSG
KDGVVVFTLGSMIKNLSEEKSNMIASALAQIPQKVLWRYTGKKPKTLGANTRLYKWIPQN
DLLGHPKTRAFITHCGTNGIYEAIYHGVPMVGIPMFGDQHDNLARMKAKGAAVEVDLQRM
TSADLLNALKAVINNTSYKENAMKLSRIHHDQPVKPLDRAVFWVEFVMRHKGAKHLRPAS
HDLNWFQYHSLDVIGFLLACVATVAFLVTKCCLFCCWKFGKTAKKKKRE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgtgaaaggtttctgcatccttttcatgctgcatctatgtctccttgactcc
gggaggatgggcaaagttcttgtatggcctgtggattttagtcactggattaatttacaa
tttattctagaagagcttcacattcatgggcatgagataactgtcctggtaccttcacaa
aatcttctgattgatcataccaaggttccctatcatgtggagatcctccagctttcagta
actgaagaaactttcatggaagagttcaatagcatgctctatgaagaaatttttgaactg
ccaaaactctcatggtgggaaatgcaaataaaactggcagacttagtcaaaaaattttta
ttaacaaacaaaagagtgtgtgacagtgctatcacaaacaaggagttactcagcaggcta
caggcagccaactttgatgtctgtattgctgaccctttaagtttttgtggggaattggtg
gctgaactcctgaatattccatttgtatacacttttcggtttttctatgggaatgccatt
gaaagattgtgtgctgggcttcctatgccttcttcatatgttcctggtgtcacatcaaga
ctgacagacaagatgacttttagacagaggctggagaactggttactgtatacagtgagt
gacatgatatattcatattatatatttccagaatgggatgaatattacagcaaggtttta
ggaaaacctacaacactatgtgagattatggggaaagctgacatgtggttgtttcgaagt
tactgggattttgaatttcctcaaccgtacttacctaatactgaatttgtcggaggactg
cattgcaagcctgcaaagcccctgcctaaggagttcgaagagtttgttcaaagctctgga
aaagatggagtcgtggtgtttactctggggtcaatgatcaaaaacctctcagaagaaaag
tctaatatgatcgcatcagcccttgcccagattcctcagaaggttctgtggagatataca
ggaaagaaacccaaaacactaggagccaatacccggctatataaatggattccacagaat
gatcttcttggtcatcccaaaaccagagcttttatcactcactgtggaaccaatgggatc
tatgaagctatttaccacggggtccctatggttggaattcctatgtttggtgatcagcat
gataatcttgctcgtatgaaagccaaaggggcagctgtcgaagtagacttgcaaagaatg
acaagtgcagatctgctgaatgctttgaaagcagttattaacaatacttcctataaagag
aatgctatgaagttatcaagaattcaccacgatcagcctgtgaaacccctggaccgagca
gtcttctgggttgagtttgtcatgcgtcacaaaggagccaaacaccttcgaccagcctcc
catgacctcaactggttccagtaccactctttggatgtgattggcttcctgctagcttgt
gtggcaactgttgcattcctggtcactaaatgttgcctgttttgttgctggaagtttggt
aagactgcaaagaagaaaaagagagagtag

DBGET integrated database retrieval system