KEGG   Bos taurus (cow): 530599Help
Entry
530599            CDS       T01008                                 

Definition
laminin subunit beta-2-like
Orthology
K06243  
laminin, beta 2
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    530599
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    530599
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    530599
 Human Diseases
  Cancers
   05200 Pathways in cancer
    530599
   05222 Small cell lung cancer
    530599
  Infectious diseases
   05146 Amoebiasis
    530599
   05145 Toxoplasmosis
    530599
Cell adhesion molecules and their ligands [BR:bta04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      530599
   VLA-6
      530599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
22
AA seq 1289 aa AA seqDB search
MMPPPGCSGGNCHPPTGNLVIGRGQSLRTSSTCGLHGPELYCVVSKLQDSQNCCFCDSRD
GKSHGIENVVSRSDPDGRKTWWQAESGVENVTIQLDLEGAFYFTHLIMTFKTFRPAALLL
ERSVDHGHSWHVFRYFAHNCSGLFPGIPPAPGRRVSDLVCDQRYSDIEPATEGEVIFQVL
DPSFLVENTNNAEIQELLRVTNLRVNFSKLHTLGDRPLGGLRGHPFYYYALYELVIAGSC
LCHGHASECRPAPGSPPSVEGMVHGHCVCRHHTTGTHCERCQGLYQDHPWQAAEPGYPHT
CQECKCHGHARSCHFDMALYLASGNVSGGVCDACQHNTAGRHCELCQPFFHRDPLEDPRS
LHSCKPCDCNPMGALEGGLCDAYTDTTRGLLSGQCRCKVHVWGQRCDSCRPGHYGLSLTQ
SEGCQPCRCNARGRVPSTQACDPSSGACHCKRFVSGRDCSRCLPEFWGLSSDSLGCRPCD
CDFGGAYSNRCSAGQGLCLCRPHLHGRHCQELQSGYFCATLDQATAEAEHGRSLQPADPQ
LPGAPWPAPRYCTPAPGTSSGWLGPRLWRQRDPDCVLQRARQARYSHQLPRTPGKPPPLH
QGSGFALGRGSDFARVVDGAGLSLLAPTVPRALDYDIVLRYETQAPEVWQALVRVRAQSQ
PRSTRCARPLPSEQLFQATLTHARRAVVLSRPFCFEPGTRYSVTLRLWRTKEGRRPEGGT
ILLDSVVLLPRVGELPGLRSVDPGALRRLQELHEAGCLEAARVSPPQSMPEACARLACSI
SALLHGGGLACECHLQGSLSTECAPLGGQCPCRPNITGRTCDRCLPGTFGLGPTGCHECR
CHPEGAASAVCNSTSGQCTCWAGCAGRRCDRCLSGRWGFPRCQPCACNGHAELCHPLTGV
CQDCRGATTGRHCERCLDGYYGDPTLGSGQRCQPCPCPGHPGSGLYHGTSCHVDSTSGRV
LCLCAPGYAGPRCDRCSPGYFGRPWPGDDPRRSPCRPCQCNNNIDPRDPAACDPHSGHCQ
RCLHHSHGAGCAHCRPGFHGSALRPGGCRRCSCDPRGTSPVRCPPEAEACFCDPVSGQCP
CRPHTLGRDCSRCAPLFWNLGGPRGCEPCSCHARHTLQPGCHPVTGQCPCRAGFGGRTCS
RCQDGYWGDPEQECRACACDPQGSISPSCDPHTGTCRCREGISGPRCQACARGSTGGFPH
CTSCPPCFASWDQRLAPLQLHLDTMVHEVAALRQGMPGWGAGLRGDQLQALEGKLQQAQT
LLESPSPTRGPLQQFTEWITGLRQGVWGH
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctcctcccggctgctcaggtggcaactgccacccacctactggcaacctggtt
attggccgtggccagagccttcgaacctcatctacctgtggcctccatggccctgaactc
tactgtgttgtcagtaaactacaggactctcagaattgctgcttttgtgattctcgggat
gggaaaagccatggcattgagaatgtggtctcccggagtgaccctgatggcagaaagacc
tggtggcaagcagagagtggtgttgagaatgtcaccatccagttggacctagaaggtgcc
ttttactttacccacctcatcatgacttttaagacattccgcccagcagctctgctcctt
gagcgctcagtggaccatggccactcctggcatgtgttccgctactttgcccacaactgc
tcaggcctctttcctgggatccctcctgcccctggccgcagagtcagtgacctcgtctgt
gaccagcgttactcagacatcgagcctgccactgagggagaggtaattttccaagttctg
gacccatcctttctggtggagaacacaaacaacgcggagattcaggaactcctgcgtgtg
actaacctccgtgtgaacttctccaagctgcacacactgggtgacaggcccctggggggc
ctcaggggccaccccttctactactatgctctctatgagctagtgattgcaggcagctgc
ctgtgccacggccatgcttccgagtgcaggcccgcacccgggtccccacccagcgtggaa
ggcatggtgcatggccattgtgtctgccgccaccacaccactggtacccactgtgaacgt
tgccagggcctgtaccaggaccacccgtggcaggcagcagagcctgggtacccccacacc
tgccaggaatgcaagtgccatgggcacgcccgcagttgtcactttgacatggccctgtat
ctcgcatctggcaacgtgagtggaggtgtgtgcgatgcatgtcaacacaacacggccggg
cgccactgtgagctctgccagcccttcttccaccgggaccccctggaggacccccgctcc
cttcactcctgcaaaccctgtgactgcaaccctatgggtgccctggaagggggtttgtgt
gatgcctacacagacaccacccggggtctcctctctgggcagtgtcgctgcaaagttcac
gtctggggccagcgctgtgactcctgccggccaggtcactatggcctgagcctcacccag
tcagaaggctgccagccctgcaggtgcaacgcccggggccgggtccccagcactcaggcc
tgtgatccatccagcggtgcctgtcactgcaaacgctttgtctctggacgggactgcagc
cgctgtctgcctgagttctggggtctgagcagtgactctctaggctgtcggccctgtgac
tgtgactttgggggtgcctacagcaacaggtgttctgcagggcagggcctctgcctctgc
cgcccccacctgcatggccgccactgccaggaactccagtctgggtacttctgcgccacc
ctcgaccaggccactgccgaagcagagcatggccgcagcctccagcctgctgacccccag
ctgcctggagccccctggcctgctccccgctactgtacaccagccccagggacctcctct
ggttggctcgggccccgactttggagacagcgtgaccctgactgtgtcctccaacgtgcc
aggcaagcccggtacagccaccagctgcccaggaccccagggaagcccccgcccctgcat
cagggatctggctttgcactggggaggggctcagacttcgcacgtgtggtggacggggct
ggcctctctctgctggcacccacagtgcctcgcgccctggactatgacatcgtcctacgc
tatgagacccaggcacctgaagtgtggcaggcattagtccgggtccgtgcccagtcacag
ccccgcagtacccgctgtgcccgtccgttgccctcagagcagctgttccaggcgaccttg
acccatgcgcgcagagccgtggttctttccagaccgttctgctttgaacccggaacccgc
tactccgtgaccctgcggctgtggcggaccaaggagggacggagacccgaagggggcacg
atcctcctggattcagtagtgctcctgccgcgggttggagagttgcctggactgaggtcc
gtggacccgggggccctgaggcgcttgcaggagctccacgaggcgggctgcctggaggca
gcgagggtgagcccaccccaaagcatgcctgaggcctgtgcccgcctcgcctgcagcatc
tcagccctgctccatggaggtggcctcgcatgtgagtgccacctgcagggttcactgagc
accgagtgtgccccactgggggggcaatgcccctgccgccctaatatcacaggtcgtacc
tgtgaccgctgcttgcctgggacatttggcctcgggcccaccgggtgccatgagtgccgc
tgccaccccgagggggctgccagtgccgtctgtaactctacgagtgggcagtgcacgtgt
tgggcaggctgtgctggtcgccgctgtgaccgttgcctctctggccggtggggcttccca
cgctgccagccctgtgcctgcaatggacacgccgagttgtgccacccactcacaggcgtc
tgccaggactgccgcggagccaccacaggccggcattgtgagaggtgcttggatggctac
tatggagaccccaccctgggctcaggccagcggtgccagccctgcccctgtcctgggcac
cctggctcaggcctctatcatgggacctcctgccatgtggacagcaccagtggacgtgtc
ctgtgcctctgtgcccccggctatgcaggaccccgctgtgaccgctgctcccccggctac
tttgggcgcccctggcctggagatgaccccagaaggagtccctgccggccctgccagtgc
aacaacaatattgatccccgtgacccagccgcctgtgacccccacagcggacattgccag
cgctgtctgcaccacagccacggcgctggctgtgcccactgccggcctggcttccacggc
agtgccctgcgcccagggggctgccggcgctgcagctgtgacccccggggcaccagccct
gtaaggtgcccacctgaggctgaagcctgcttctgtgacccggtcagcgggcagtgcccc
tgccgcccccacacactggggcgggactgtagccgctgtgcccccctcttctggaacctc
ggggggccccggggctgtgagccctgcagctgccacgcccgacacactttgcagccgggg
tgtcacccggtcacgggtcagtgcccctgccgggcaggatttgggggccgcacgtgctcc
cggtgtcaggatgggtactggggtgacccggagcaggagtgcagagcctgtgcctgtgac
ccccagggctccatctcgcccagctgtgacccgcacacaggcacctgccgctgccgagag
ggtatctcagggccgaggtgccaggcgtgtgcccgtggctccacaggaggcttcccacac
tgcacgtcctgccctccctgcttcgcctcctgggaccaacgcctggctcccctccagctg
catctggacaccatggtccatgaggtggctgccctgcgccagggcatgcctggctggggt
gctgggctccggggagatcagctgcaggccctggagggtaaactccagcaggctcagaca
ctcctggaatcaccttcccccaccagaggtcccctgcaacaatttacagagtggatcacc
ggactcaggcaaggggtctggggtcattag

DBGET integrated database retrieval system