KEGG   Bos taurus (cow): 530642Help
Entry
530642            CDS       T01008                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta00240  Pyrimidine metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    530642 (DCK)
   00240 Pyrimidine metabolism
    530642 (DCK)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     530642 (DCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 DUF932 CoaE
Motif
Other DBs
NCBI-GeneID: 530642
NCBI-ProteinID: NP_001029745
BGD-bta: BT21331
Ensembl: ENSBTAG00000012397
UniProt: Q3MHR2
Position
6
AA seq 260 aa AA seqDB search
MATPPKRSCPSPAASSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHDSLIEKVKDFLSTL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccacccaagaggagctgcccgtctcccgcagccagctctgaggggacccgc
atcaagaaaatttccatcgaagggaacatcgctgctgggaagtcaacatttgtgaatatc
cttaaacaagtctgtgaggactgggaagtggtgcctgaacctgttgccaggtggtgcaat
gttcagagtactcaggatgaatttgaggaactgacaacatctcagaaaagtggcgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccagtcatatgcc
tgcctcagtcgaatacgagctcagcttgccgctctcaatggaaaactcaaagatgcagag
aaaccagtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggaccatttatcaagactggcatgac
tggatgaataaccagtttggccaaagccttgaactggatggaatcatttatcttagagcc
actccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatatttggagaaacttcactataagcatgaaagctggctcctgcatagaaca
ctaaaaaccaactttgattatctacaagaagtgcctatcttaacactggatgttaatgaa
gactttaaagacaaacatgacagtctaattgaaaaggtaaaagactttttgagcactttg
tga

DBGET integrated database retrieval system