KEGG   Bos taurus (cow): 530929Help
Entry
530929            CDS       T01008                                 

Definition
cytochrome P450, family 2, subfamily J
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bta00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:bta00591]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:bta04913]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:bta04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:bta04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
3
AA seq 502 aa AA seqDB search
MLEALGSLAAALWAALRPGTVLLGAIVFLLLTDLLNRRRPKNYPPGPPRLPFVGNFFQLD
FEQGHLSLQRFVKKYGNLFSLEFGDLPSVVITGLPLIKEVLVYQDQNFVNRPISPIRERV
FKKNGLIMSNGHIWKEQRRFSLTALRNFGLGRKSLEERIQEEVAYLIQAIGEEKGQPFNP
HFKINNAVSNIICSITFGERFDYQDDQFQELLRLLDEVTYLETTVWCQLYNVFPRIMNFL
PGPHQMLFSNWRKLKMFVARVIENHKRDWNPAEARDFIDAYLQETEKHKGNAASSFHEEN
LIYNTLDLFFAGTETTSTTLRWGLLYMALYPEIQEKVQAEIDKVLGESQQPSTAARESMP
YTNAVIHEVQRMGNILPLNVPREVTVDTVLAGYHLPKGTMVLTNLTALHRDPAEWATPDT
FNPEHFLENGQFKKREAFLPFSIGKRMCLGEQLARTELFIFFTSLLQKFTFRPPDNEELS
LKFRMGLTLSPVSHCLCAVPRA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgttggaggcgttgggctccctggcggctgccctctgggccgcgctccgtcctggcact
gtcctgctgggggccatcgtctttctcctcttgactgatctcctcaacaggcggcgtcca
aagaactatccgccggggcccccgcgcctgcccttcgtaggcaacttcttccaactggac
tttgagcagggacacctgtcgcttcagcggtttgtgaagaaatacgggaacctttttagc
ctggaattcggtgacttgccttcagttgttataactggattgcccttaatcaaagaagtc
cttgtctaccaggaccaaaactttgtgaaccgccccataagccctattcgagagcgtgtt
tttaagaaaaatggcttgatcatgtccaatggccacatatggaaagagcaaagaaggttc
tccctgacagctctgaggaactttggtttaggaaggaagagcttagaggaacgcatacag
gaagaagttgcctacctcatccaggcaataggagaggagaaaggacagcctttcaaccct
cacttcaaaatcaacaatgctgtttccaatattatttgctccatcaccttcggggagcgg
tttgactaccaggatgatcagttccaggagctgctgaggctgctggatgaggtcacctac
ttagagacaacagtgtggtgccagctctacaatgtctttccaaggataatgaatttcctt
ccgggtccacaccaaatgctcttcagtaactggaggaaactgaaaatgtttgttgcccgt
gtgattgaaaaccacaagagagactggaatcctgctgaagcaagagacttcattgatgct
tatctccaggagacagaaaagcataagggtaatgctgcttcaagtttccatgaagaaaac
cttatctacaataccctggacctcttctttgctggaacagagacaacttcaaccaccttg
cgctggggtctgctctacatggccctgtaccctgaaatccaagagaaagtccaagctgaa
atcgataaggtgcttggtgagtcacaacaaccaagcacggccgctcgcgagtccatgccc
tacaccaacgctgtcatccacgaggtgcagagaatggggaacatcctccctctgaacgtg
ccccgggaggtgacagtggacaccgtcctggctggataccacctgcccaagggtaccatg
gtgctgaccaacctgactgcactgcacagggaccccgcagagtgggccacccctgacaca
ttcaatccggagcattttctagagaatggacagtttaagaaaagggaagcctttctgcct
ttttcaataggaaagaggatgtgccttggagaacaattggccagaactgagttgtttatt
ttttttacctcacttctgcaaaaatttaccttcaggcctccagacaatgaagagttaagc
ctgaagttcagaatgggcttgaccctctccccagtcagccattgcctctgtgctgttcct
cgggcctga

DBGET integrated database retrieval system