KEGG   Bos taurus (cow): 530929Help
Entry
530929            CDS       T01008                                 

Definition
(RefSeq) cytochrome P450, family 2, subfamily J
  KO
K07418  cytochrome P450 family 2 subfamily J [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00590  Arachidonic acid metabolism
bta00591  Linoleic acid metabolism
bta01100  Metabolic pathways
bta04726  Serotonergic synapse
bta04750  Inflammatory mediator regulation of TRP channels
bta04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    530929
   00591 Linoleic acid metabolism
    530929
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    530929
  Nervous system
   04726 Serotonergic synapse
    530929
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    530929
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     530929
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP2 family
   530929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 530929
NCBI-ProteinID: XP_002686394
BGD-bta: BT19393
Ensembl: ENSBTAG00000038085
Position
3
AA seq 502 aa AA seqDB search
MLEALGSLAAALWAALRPGTVLLGAIVFLLLTDLLNRRRPKNYPPGPPRLPFVGNFFQLD
FEQGHLSLQRFVKKYGNLFSLEFGDLPSVVITGLPLIKEVLVYQDQNFVNRPISPIRERV
FKKNGLIMSNGHIWKEQRRFSLTALRNFGLGRKSLEERIQEEVAYLIQAIGEEKGQPFNP
HFKINNAVSNIICSITFGERFDYQDDQFQELLRLLDEVTYLETTVWCQLYNVFPRIMNFL
PGPHQMLFSNWRKLKMFVARVIENHKRDWNPAEARDFIDAYLQETEKHKGNAASSFHEEN
LIYNTLDLFFAGTETTSTTLRWGLLYMALYPEIQEKVQAEIDKVLGESQQPSTAARESMP
YTNAVIHEVQRMGNILPLNVPREVTVDTVLAGYHLPKGTMVLTNLTALHRDPAEWATPDT
FNPEHFLENGQFKKREAFLPFSIGKRMCLGEQLARTELFIFFTSLLQKFTFRPPDNEELS
LKFRMGLTLSPVSHCLCAVPRA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgttggaggcgttgggctccctggcggctgccctctgggccgcgctccgtcctggcact
gtcctgctgggggccatcgtctttctcctcttgactgatctcctcaacaggcggcgtcca
aagaactatccgccggggcccccgcgcctgcccttcgtaggcaacttcttccaactggac
tttgagcagggacacctgtcgcttcagcggtttgtgaagaaatacgggaacctttttagc
ctggaattcggtgacttgccttcagttgttataactggattgcccttaatcaaagaagtc
cttgtctaccaggaccaaaactttgtgaaccgccccataagccctattcgagagcgtgtt
tttaagaaaaatggcttgatcatgtccaatggccacatatggaaagagcaaagaaggttc
tccctgacagctctgaggaactttggtttaggaaggaagagcttagaggaacgcatacag
gaagaagttgcctacctcatccaggcaataggagaggagaaaggacagcctttcaaccct
cacttcaaaatcaacaatgctgtttccaatattatttgctccatcaccttcggggagcgg
tttgactaccaggatgatcagttccaggagctgctgaggctgctggatgaggtcacctac
ttagagacaacagtgtggtgccagctctacaatgtctttccaaggataatgaatttcctt
ccgggtccacaccaaatgctcttcagtaactggaggaaactgaaaatgtttgttgcccgt
gtgattgaaaaccacaagagagactggaatcctgctgaagcaagagacttcattgatgct
tatctccaggagacagaaaagcataagggtaatgctgcttcaagtttccatgaagaaaac
cttatctacaataccctggacctcttctttgctggaacagagacaacttcaaccaccttg
cgctggggtctgctctacatggccctgtaccctgaaatccaagagaaagtccaagctgaa
atcgataaggtgcttggtgagtcacaacaaccaagcacggccgctcgcgagtccatgccc
tacaccaacgctgtcatccacgaggtgcagagaatggggaacatcctccctctgaacgtg
ccccgggaggtgacagtggacaccgtcctggctggataccacctgcccaagggtaccatg
gtgctgaccaacctgactgcactgcacagggaccccgcagagtgggccacccctgacaca
ttcaatccggagcattttctagagaatggacagtttaagaaaagggaagcctttctgcct
ttttcaataggaaagaggatgtgccttggagaacaattggccagaactgagttgtttatt
ttttttacctcacttctgcaaaaatttaccttcaggcctccagacaatgaagagttaagc
ctgaagttcagaatgggcttgaccctctccccagtcagccattgcctctgtgctgttcct
cgggcctga

DBGET integrated database retrieval system