KEGG   Bos taurus (cow): 531139Help
Entry
531139            CDS       T01008                                 

Gene name
USP40
Definition
ubiquitin specific peptidase 40
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
3
AA seq 1232 aa AA seqDB search
MFGDLFEEDYSSVSNNNGKGKRLKTKALEPPAPREFTNLSGIRNQGGTCYLNSLLQTLHF
TPEFREALFSLGLEELGSLEDKDKPDAKVRIIPLQLQRLFAQLLLLDQKAVSTADLTDSF
GWTSDEEMRQHDVQELNRILFSALETSLVGTSGHDLINRLYHGTIVNQIVCKECKNVSEK
QEDFLDLTVAVKNVSGLEDALWNMYVEEEVFDCDNLYHCGNCDRLVKAAKSAKLRKLPPF
LTISLLRFNFDFVKCERYKETSCYTFPLRINLKPFCEQSELDDLEYMYDLFSVIIHKGGC
YGGHYHVYIKDVDHLGNWQFQEDKSKPDVNLEDIQNKEEVDDPLMILKAILLQESNLIPV
DQLGQKLLKKIGISWNKKYRKQYGPLRKFLQVHSQIFLLSSDESTVRLLKDSSLQAESDI
QRNDQRLFKTLTSESLTLNDRPSCPHWFDINDSTVQPIKEKDIEQQFQGKESAYMLFYRK
SQLQRPPEARANPRYKVPCHLLSEMDAANIELQIKRAECDSTNNTIELHLHLGPHYHFFN
GALHPVVSQTESMWDLTFDKRKTLGDLRQSIFQLLEFWEGDMVLSVAKFVPAGLHVCQTL
NGDDLALCEIEITDGEDIFVWNGVEVGGIQIPTGSDCEPLLLNVLHVATSSEGEECQQLI
ESPHVFPSNAEIGTVFTALAIPEGVILINNTESRGGESWITIPKEDLKKTFREQGLRNGS
SVLIQGSNNGNSLLTKQGKWIDTVNEINWLQVRNLSQLESEEEQVKISATLNTVVFDIRI
KAIKELKLLKELAENSCLRPIDRNGKLLCPVPDRCTLKEAGLKMGSSLGLCPGKAPTSSQ
LFLFFALGSDVHPGTEMEIIVEETISVRDCLKIMLDKCGLTGETWHLRKMDWCFEAGEPL
CEEDAKLKELMICSGDTLLLIEGKLPPLGFLTVPIWWYQPQGPLHHWKDHQDQTNCTLSQ
GSVWKASSTPGAPSDAHAEVSLWYLGDLEISEDATLGELKSQAMTLPSLEFSIPSPAFLR
AWTVENKRPGRLLRGHQQQLKEYKLGKRTEICLEPLQKEENLGPWDVLLRTQMRLPGKRA
YGPPVDVLWDTARGWTASSLRQRVADVYSLPVEKIEIAKYFPDKFAWLPVSSWSQQTTKR
KKKKKQDNLQGAPYYLKDGDTIGVKNLLVEDDDDFSTVQDDIGREKLKEVALGKRKSREA
LRAQSSDVSSVEMPAQARGPEASLSIHVGSFR
NT seq 3699 nt NT seq  +upstreamnt  +downstreamnt
atgtttggggacctatttgaagaagattattccagtgtgtcaaataataatggaaaaggg
aagagattaaagaccaaagctttggagccacctgctcctagagaattcaccaatttaagt
ggaatcagaaatcagggtggaacctgttacctcaattcccttcttcagactcttcatttc
acacctgaattcagagaagcgttattctctcttggcctggaagagcttggttcgttagag
gacaaggataaacctgatgcaaaggtccgaatcatacctttgcagttacagcggttgttt
gcacaacttctcctcttagaccagaaagctgtatccacagccgacctcactgacagcttt
gggtggaccagtgatgaggaaatgaggcaacatgatgtgcaggaactgaatcgaattctc
tttagtgctttggaaacttctttagttggaacctccggccatgacctcatcaaccgtcta
tatcacggaaccattgttaaccagattgtttgtaaagaatgtaagaatgtcagtgaaaag
caggaagatttcctagatctaacagtagcagtcaaaaatgtatcaggtttggaagatgca
ctctggaacatgtatgtagaggaggaagtttttgactgtgacaacttataccactgtgga
aactgtgacaggctggttaaagcagcaaagtcggccaaattacgtaagctgcctcccttt
cttacaatttcattattaagatttaattttgattttgtgaagtgtgaacgatacaaggaa
acaagctgttatacattccctctccggatcaatctcaagcctttttgtgaacagagtgaa
ttagatgacttggaatatatgtatgacctcttctcagttattatacacaaaggtggttgc
tatggaggacattatcacgtgtatattaaagatgtcgatcatttgggaaactggcagttt
caagaggacaaaagtaaaccagatgtgaatttggaagatattcagaataaagaggaggtt
gatgatccattgatgattctaaaagcaattttattacaggagagtaatctaattcccgtt
gatcagctgggccagaaactcttgaagaagataggaatatcttggaataagaagtaccga
aaacagtatggaccactgcgaaagtttttgcaggttcattctcagatatttctgctcagt
tcagatgaaagtacagttcgtctattgaaggattcttctctccaggctgagtctgatatc
caaagaaatgatcaacgacttttcaagacacttacttcagaatccttaacattaaatgat
agaccctcctgtccccactggtttgatataaatgattccacagtccaaccaatcaaggaa
aaggatattgaacagcaatttcaaggaaaagaaagtgcctacatgctgttttatcgaaaa
tcccagttacagagaccccctgaagctcgagctaacccacgatacaaggttccatgtcat
ttgctgagtgaaatggatgcagctaacattgaactacaaataaaaagggcagaatgtgat
tctacaaacaatactattgagttacatctccacctcggcccccattatcatttcttcaat
ggggctctgcacccagtagtgtctcaaacagaaagcatgtgggatttgacctttgataaa
aggaaaactttaggagatcttcgacaatcaatatttcagctgttagaattttgggaagga
gatatggttcttagtgttgcaaagtttgtaccagcaggacttcatgtctgccagacactt
aatggagatgacctggcactgtgtgaaattgaaatcactgacggagaagacatctttgta
tggaatggggtagaggttggtggaatccagattccaaccggtagcgactgtgaacctctg
cttttaaatgttcttcatgtagcaacaagcagtgagggagaggagtgccagcagttgata
gaatctccacatgtctttccatctaatgcggaaataggcactgtattcacagccctagca
attccagagggagtcatcttaatcaacaacactgaatctagaggtggagagagctggatc
accattcccaaggaagacttgaaaaagacattcagagagcaaggcctcagaaacggaagc
tcagttttaatccagggctctaataatggtaacagtttgttgacaaaacaagggaaatgg
atcgatactgtgaatgagatcaactggctccaagttagaaatttaagccaattagaatct
gaagaggaacaagttaaaatatcagcaactcttaacacagtggtgtttgatattcgaatt
aaagccataaaggaattaaaattattgaaggaactagctgagaacagctgtttgaggcct
attgatagaaatgggaaactgctttgtccagtgccagacagatgcactctgaaggaagca
ggactgaagatggggagttcactgggactgtgtcctggaaaagcaccaacttcctctcag
ctgttcctgttttttgctttggggagtgatgttcaccctgggacagagatggagatcata
gtagaggaaacaatatctgtgagggattgtctgaagataatgctggacaaatgtggcctc
acaggagaaacatggcatttacgaaaaatggattggtgctttgaagctggggagccttta
tgtgaagaagatgcaaagctgaaagagcttatgatctgttctggagatactttgctttta
attgaaggaaaacttcctcctctgggtttcctgacggtgcccatctggtggtaccagcct
caggggccgctgcatcactggaaggatcaccaggaccagacgaattgtaccctttctcaa
ggcagcgtctggaaagccagttccactccaggtgctcccagtgacgcacacgcggaagtt
tccctctggtacttgggagaccttgaaatctcagaagatgccaccttaggggagctgaag
tctcaggccatgaccttgccctccttggagttttccatcccatccccagccttcctcaga
gcctggacagtggaaaataagcgcccaggccggctcttacgaggccaccagcagcagctc
aaggaatataaattgggaaagagaactgagatctgcttagagccccttcagaaagaagaa
aacttgggcccctgggacgtgctgctgcggacacagatgcgccttcctggcaagagagcc
tacggcccgcccgtggacgtgctgtgggacacagcccgcggctggacggccagctccctg
aggcagcgagtggccgatgtctactcacttcccgtggagaaaattgaaattgccaaatac
tttcctgacaagtttgcatggcttccagtgtctagttggagccagcaaactaccaaaagg
aaaaagaagaaaaagcaagataatttgcagggtgcaccttattacttgaaagatggagat
actattggtgttaagaatctcctggttgaagacgatgatgatttcagtaccgtccaagac
gacatcggaagagaaaaactgaaagaggtcgccctggggaaaaggaaaagccgggaggcc
ctccgtgcgcagagcagcgatgtctctagtgtagagatgcccgcccaggcccgtggacca
gaagcttctctctccatccatgtcgggagcttcagatag

DBGET integrated database retrieval system