KEGG   Bos taurus (cow): 531139Help
Entry
531139            CDS       T01008                                 

Gene name
USP40
Definition
(RefSeq) ubiquitin specific peptidase 40
  KO
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     531139 (USP40)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   531139 (USP40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
3
AA seq 1286 aa AA seqDB search
MFGDLFEEDYSSVSNNNGKGKRLKTKALEPPAPREFTNLSGIRNQGGTCYLNSLLQTLHF
TPEFREALFSLGLEELGSLEDKDKPDAKVRIIPLQLQRLFAQLLLLDQKAVSTADLTDSF
GWTSDEEMRQHDVQELNRILFSALETSLVGTSGHDLINRLYHGTIVNQIVCKECKNVSEK
QEDFLDLTVAVKNVSGLEDALWNMYVEEEVFDCDNLYHCGNCDRLVKAAKSAKLRKLPPF
LTISLLRFNFDFVKCERYKETSCYTFPLRINLKPFCEQSELDDLEYMYDLFSVIIHKGGC
YGGHYHVYIKDVDHLGNWQFQEDKSKPDVNLEDIQNKEEVDDPLMILKAILLQEESNLIP
VDQLGQKLLKKIGISWNKKYRKQYGPLRKFLQVHSQIFLLSSDESTVRLLKDSSLQAESD
IQRNDQRLFKTLTSESLTLNDRPSCPHWFDINDSTVQPIKEKDIEQQFQGKESAYMLFYR
KSQLQRPPEARANPRYKVPCHLLSEMDAANIELQIKRAECDSTNNTIELHLHLGPHYHFF
NGALHPVVSQTESMWDLTFDKRKTLGDLRQSIFQLLEFWEGDMVLSVAKFVPAGLHVCQT
LNGDDLALCEIEITDGEDIFVWNGVEVGGIQIPTGSDCEPLLLNVLHVATSSEGEECQQL
IESPHVFPSNAEIGTVFTALAIPEGVILINNTESRGGESWITIPKEDLKKTFREQGLRNG
SSVLIQGSNNGNSLLTKQGKWIDTVNEINWLQVRNLSQLESEEEQVKISATLNTVVFDIR
IKAIKELKLLKELAENSCLRPIDRNGKLLCPVPDRCTLKEAGLKMGSSLGLCPGKAPTSS
QLFLFFALGSDVHPGTEMEIIVEETISVRDCLKIMLDKCGLTGETWHLRKMDWCFEAGEP
LCEEDAKLKELMICSGDTLLLIEGKLPPLGFLTVPIWWYQPQGPLHHWKDHQDQTNCTLS
QGSVWKASSTPGAPSDAHAEVSLWYLGDLEISEDATLGELKSQAMTLPSLEFSIPSPAFL
RAWTVENKRPGRLLRGHQQQLKEYKLGKRTEICLEPLQKEENLGPWDVLLRTQMRLPGKR
AYGPPVDVLWDTARGWTASSLRQRVADVYSLPVEKIEIAKYFPDKFAWLPVSSWSQQTTK
RKKKKKQDNLQGAPYYLKDGDTIGVKNLLVEDDDDFSTVQDDIGREKLKEVALGKRKRCA
NFSLALPAWILPQDPVCLRPQCLLHPRAVSPCCLCPRSVCLLPWSLPTSLQRLPEYPQHL
PTSPKCSVWSECATLGRTCRSDRDVW
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atgtttggggacctatttgaagaagattattccagtgtgtcaaataataatggaaaaggg
aagagattaaagaccaaagctttggagccacctgctcctagagaattcaccaatttaagt
ggaatcagaaatcagggtggaacctgttacctcaattcccttcttcagactcttcatttc
acacctgaattcagagaagcgttattctctcttggcctggaagagcttggttcgttagag
gacaaggataaacctgatgcaaaggtccgaatcatacctttgcagttacagcggttgttt
gcacaacttctcctcttagaccagaaagctgtatccacagccgacctcactgacagcttt
gggtggaccagtgatgaggaaatgaggcaacatgatgtgcaggaactgaatcgaattctc
tttagtgctttggaaacttctttagttggaacctccggccatgacctcatcaaccgtcta
tatcacggaaccattgttaaccagattgtttgtaaagaatgtaagaatgtcagtgaaaag
caggaagatttcctagatctaacagtagcagtcaaaaatgtatcaggtttggaagatgca
ctctggaacatgtatgtagaggaggaagtttttgactgtgacaacttataccactgtgga
aactgtgacaggctggttaaagcagcaaagtcggccaaattacgtaagctgcctcccttt
cttacaatttcattattaagatttaattttgattttgtgaagtgtgaacgatacaaggaa
acaagctgttatacattccctctccggatcaatctcaagcctttttgtgaacagagtgaa
ttagatgacttggaatatatgtatgacctcttctcagttattatacacaaaggtggttgc
tatggaggacattatcacgtgtatattaaagatgtcgatcatttgggaaactggcagttt
caagaggacaaaagtaaaccagatgtgaatttggaagatattcagaataaagaggaggtt
gatgatccattgatgattctaaaagcaattttattacaggaggagagtaatctaattccc
gttgatcagctgggccagaaactcttgaagaagataggaatatcttggaataagaagtac
cgaaaacagtatggaccactgcgaaagtttttgcaggttcattctcagatatttctgctc
agttcagatgaaagtacagttcgtctattgaaggattcttctctccaggctgagtctgat
atccaaagaaatgatcaacgacttttcaagacacttacttcagaatccttaacattaaat
gatagaccctcctgtccccactggtttgatataaatgattccacagtccaaccaatcaag
gaaaaggatattgaacagcaatttcaaggaaaagaaagtgcctacatgctgttttatcga
aaatcccagttacagagaccccctgaagctcgagctaacccacgatacaaggttccatgt
catttgctgagtgaaatggatgcagctaacattgaactacaaataaaaagggcagaatgt
gattctacaaacaatactattgagttacatctccacctcggcccccattatcatttcttc
aatggggctctgcacccagtagtgtctcaaacagaaagcatgtgggatttgacctttgat
aaaaggaaaactttaggagatcttcgacaatcaatatttcagctgttagaattttgggaa
ggagatatggttcttagtgttgcaaagtttgtaccagcaggacttcatgtctgccagaca
cttaatggagatgacctggcactgtgtgaaattgaaatcactgacggagaagacatcttt
gtatggaatggggtagaggttggtggaatccagattccaaccggtagcgactgtgaacct
ctgcttttaaatgttcttcatgtagcaacaagcagtgagggagaggagtgccagcagttg
atagaatctccacatgtctttccatctaatgcggaaataggcactgtattcacagcccta
gcaattccagagggagtcatcttaatcaacaacactgaatctagaggtggagagagctgg
atcaccattcccaaggaagacttgaaaaagacattcagagagcaaggcctcagaaacgga
agctcagttttaatccagggctctaataatggtaacagtttgttgacaaaacaagggaaa
tggatcgatactgtgaatgagatcaactggctccaagttagaaatttaagccaattagaa
tctgaagaggaacaagttaaaatatcagcaactcttaacacagtggtgtttgatattcga
attaaagccataaaggaattaaaattattgaaggaactagctgagaacagctgtttgagg
cctattgatagaaatgggaaactgctttgtccagtgccagacagatgcactctgaaggaa
gcaggactgaagatggggagttcactgggactgtgtcctggaaaagcaccaacttcctct
cagctgttcctgttttttgctttggggagtgatgttcaccctgggacagagatggagatc
atagtagaggaaacaatatctgtgagggattgtctgaagataatgctggacaaatgtggc
ctcacaggagaaacatggcatttacgaaaaatggattggtgctttgaagctggggagcct
ttatgtgaagaagatgcaaagctgaaagagcttatgatctgttctggagatactttgctt
ttaattgaaggaaaacttcctcctctgggtttcctgacggtgcccatctggtggtaccag
cctcaggggccgctgcatcactggaaggatcaccaggaccagacgaattgtaccctttct
caaggcagcgtctggaaagccagttccactccaggtgctcccagtgacgcacacgcggaa
gtttccctctggtacttgggagaccttgaaatctcagaagatgccaccttaggggagctg
aagtctcaggccatgaccttgccctccttggagttttccatcccatccccagccttcctc
agagcctggacagtggaaaataagcgcccaggccggctcttacgaggccaccagcagcag
ctcaaggaatataaattgggaaagagaactgagatctgcttagagccccttcagaaagaa
gaaaacttgggcccctgggacgtgctgctgcggacacagatgcgccttcctggcaagaga
gcctacggcccgcccgtggacgtgctgtgggacacagcccgcggctggacggccagctcc
ctgaggcagcgagtggccgatgtctactcacttcccgtggagaaaattgaaattgccaaa
tactttcctgacaagtttgcatggcttccagtgtctagttggagccagcaaactaccaaa
aggaaaaagaagaaaaagcaagataatttgcagggtgcaccttattacttgaaagatgga
gatactattggtgttaagaatctcctggttgaagacgatgatgatttcagtaccgtccaa
gacgacatcggaagagaaaaactgaaagaggtcgccctggggaaaaggaaaaggtgtgcc
aatttctccctggccctgccggcctggattctgcctcaggatcctgtctgcctgcgtccc
cagtgtctactgcatccccgcgctgtgtccccgtgctgtctgtgtccccgcagtgtctgc
ctgcttccctggtctctacctacatccctgcagcgcctacctgagtacccacagcattta
cccacgtccccaaaatgctcggtgtggtcagaatgtgcaactctaggacgcacttgcaga
tctgacagggacgtttggtaa

DBGET integrated database retrieval system