KEGG   Bos taurus (cow): 531699Help
Entry
531699            CDS       T01008                                 

Gene name
AOX3L1
Definition
aldehyde oxidase 1-like
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
bta  Bos taurus (cow)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    531699 (AOX3L1)
   00350 Tyrosine metabolism
    531699 (AOX3L1)
   00380 Tryptophan metabolism
    531699 (AOX3L1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    531699 (AOX3L1)
   00760 Nicotinate and nicotinamide metabolism
    531699 (AOX3L1)
   00830 Retinol metabolism
    531699 (AOX3L1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    531699 (AOX3L1)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     531699 (AOX3L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 1342 aa AA seqDB search
MPCPSRSDELVFFVNGRKVIERNADPEVTLLSFLRKNLRLTGTKYACGRGGCGACTVMVS
KRDPTSQEIRHFSVTACLVPICSLYGAAVTTVEGVGSMKTRLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHPQPSEEQLLEALGGNLCRCTGYRPILASGKTFCLESNGCQQKGTG
KCCLDLGENDSSSLGRKSDICTELFVKEEFQPLDPTQELIFPPELLRMTENPEKRTLTFH
GERVTWISPGTFKDLLELKAKHPEAPLILGNTSLGPAMRSKGCLHPILLSPARISELNVV
SKTNDGLTIGAGCSLAQVKDILAERVSELPEEKTQTYRALLKHLKSLASQQIRNMASLGG
HIISRHSYSDLNPILAVGNATLNLTSEGTRRIPLSEHFLAGLASADLKPEEILESVYIPH
SQKWEFVSAFRQAQCQQNALPDVNAGMRVLFKEGTDIIEDLSITYGGVGAATVSAHKSCQ
QLLGRQWDELMLDEACRRLLDEVSLPGWAPGGRVEFKRTLVVSFFFKFYLQVLQELKKLI
KPFPNSRRYPEISDRFLSALEDFPGTVPQGVQRYQSVDSHQPLQDPVGRPVMHLSGLKHA
TGEAEFCDDIPMVDKELCMALVTSTRAYAKIISIDLSEALEIPGVVDVITAKDIPGTNGT
EDDKLLAVDEVLCVGQIICAVVAETDVQAKRAIEKIKITYEELEPIIFTIKDAIKHNSFL
CPEKKLEQGNIEEAFEKVDQIVEGEVHVGGQEHFYMETQRVLVIPKTEDKELDIYVSTQD
PAHVQKTVSSTLNIPINRITCHVKRVGGGFGGKIGRPAVFGAIAAVGALKTGHPIRLVLD
REDDMLITGGRHPLFGKYKVGFMNNGRIKALDIECFINGGCTLDDSELVTEFLILKLENA
YKIRNLRFRGRACLTNLPSNTAFRGFGFPQGTLVTESCITAVAAKCGLPPEKIREKNMYR
TVDKAIYKQAFNPESLIRCWNECLDVSSFHNRRKQVEEFNKKNYWKKRGIAVIPMKFSVG
FAATSYHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELKIPMSHLHICETST
AMVPNTIATAASVGADINGKAVQNACQILLKRLEPIIKKNPEGTWEEWIEAAFEQRISLS
ATGYFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIVMDACCSLNP
AIDIGQIEGAFIQGMGLYTTEELKYSPEGVLYSRGPDEYKIPTISDVPEEFNVSLLPSSQ
TPLTIYSSKGLGESGMFLGSSVFFAITDAVAAARKERDIAEDFTVKSPATPEWVRMACAD
RFTEMIPRDDPKTFKPWSITVA
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgccttgcccgtcgagatcggatgagctggttttctttgtgaacgggaggaaggtgatt
gaaaggaatgcagacccagaagtcactctcttgagcttcctaagaaagaacttgcgcctc
accggaaccaagtacgcctgcggaagaggaggctgcggtgcctgcaccgtgatggtgtct
aagcgagaccccacgtcccaggagataagacacttctctgtcaccgcctgcctggtgccc
atctgctctctgtatggggctgctgtcaccactgtggaaggtgttggaagcatgaaaacc
aggcttcaccccgtgcaggagaggattgccaagagccacggtacccagtgcggcttctgc
acccctgggatggtgatgtccatgtacacgctgctgaggaaccacccacagccctctgag
gagcaactgctggaagccctggggggtaacctgtgccgctgcactggatatcggccaatt
ctcgcaagcgggaagaccttttgtttggagtcaaatggctgtcaacagaaaggaacagga
aaatgctgcctggatctgggagaaaatgattcttcctcgcttggcaggaaaagtgacatt
tgcacagagttatttgtgaaagaggagttccagcccttggaccctacccaggagctcata
tttcccccggaactcttgagaatgacagagaacccagaaaaacgaaccctgacctttcac
ggagagagggttacttggatctcccctgggaccttcaaagacctcctggagctgaaagca
aaacacccagaagccccgctcatcctgggcaacacatcactgggacctgccatgagatct
aaaggatgtttgcacccaattctcctctctcctgctaggatttctgagctgaatgtggtg
tctaaaacaaatgatggactgacaataggtgctggctgcagtctggcccaggtcaaggac
atcttggctgagagggtctccgagctcccggaggagaagacccagacgtaccgagcgctg
ctgaagcacctgaagagtctggccagccagcagatccggaacatggcttctttagggggt
catattataagccgacatagctactcagatctgaacccaattctggctgtgggcaacgct
accctcaatctgacatcagaaggcacacggcggattcctctaagtgaacattttcttgct
gggttggcaagtgcagacctgaagccggaagaaattttggagtctgtgtatattcctcac
tctcaaaagtgggaattcgtgtcagccttccgacaggctcagtgccagcaaaacgccttg
cccgacgtgaatgccggcatgcgagtcctcttcaaagagggcacagacatcatcgaggac
ctgagcatcacctatggaggggtcggggctgccacagtcagtgcacataagtcctgccag
cagctcctagggaggcagtgggatgagctgatgctggatgaagcttgcaggcggctcctg
gacgaagtctccctcccaggctgggctccaggtgggagggtggaattcaagaggactctg
gtagtcagcttcttcttcaagttctacctacaagttctgcaggaactgaagaagctcata
aagccgttccctaacagccgccgttatcctgaaatttcagaccgattcctgagcgctcta
gaagacttcccgggcacggttccccagggagtccaaaggtaccagagtgtggattctcac
cagcccctccaagatccagtcggacgccctgtcatgcacctatcgggtctcaaacacgcc
accggggaggccgagttttgtgatgacatccccatggtggataaagaactctgcatggct
ttagtgaccagtaccagagcctatgcaaaaatcatatcaattgatttgtccgaggccctt
gaaatacctggggtggttgatgtgataacagcgaaggacattccaggcaccaatggcacc
gaagatgacaaactgttggccgtagatgaggtactctgcgtgggccagatcatctgtgct
gtggttgcagaaacagatgtacaggcaaaacgtgctattgaaaagataaagataacttat
gaagagctggagcccataatcttcaccatcaaggatgccataaaacacaactcattcctg
tgccctgaaaaaaaacttgaacaaggaaacatcgaggaggcatttgaaaaagttgatcaa
attgttgaaggagaggtccatgtcggaggacaggagcatttttacatggaaacacagaga
gtgcttgttattccaaagacagaggacaaagaactggacatttatgtgtcaacacaggat
ccagcccacgtgcagaaaacagtgtcctccactttaaacatccccatcaacaggatcacc
tgtcatgtaaagcgagtgggtggaggttttggcgggaagataggaagaccggctgtcttc
ggggctattgcagctgtgggtgctctcaaaactggtcaccccatccgtcttgttcttgat
cgtgaagatgatatgttaataactgggggaagacacccattatttggaaaatataaagtg
ggattcatgaacaacgggcgaatcaaagctctagacatcgagtgcttcattaacggaggg
tgcacgttggatgactcagagctggtaacagaatttcttatcttgaagctggaaaatgca
tataaaatccgcaacctcaggttccggggccgtgcatgcctgacaaatttaccatccaac
acggcctttcgaggatttggcttcccccaaggaaccctggtaacagaatcatgcatcaca
gctgtggcagccaaatgtggccttccgccagaaaagattagggagaaaaacatgtaccga
acagttgataaagccatctacaaacaagcgttcaaccctgagagcctgataagatgttgg
aacgaatgtctggacgtgtcttcctttcacaacagaagaaagcaagtggaagagttcaat
aagaagaactactggaagaaaagaggcattgcggtgattcccatgaaattttcagtcggc
tttgctgcaacaagctatcatcaggcagctgcgctggttcatatttacactgacgggtct
gtattggtcacacatggaggcaacgaactgggacaaggtattcacaccaaaatgctgcag
gtggccagccgtgaattaaaaatacccatgtctcacttgcacatctgtgaaacaagtacc
gccatggtgcctaatacaatcgctacagcagcatccgtcggagcagatatcaatggcaaa
gccgtgcagaatgcttgtcagatccttctgaaacgccttgagcccatcattaagaaaaat
ccagaaggtacctgggaagaatggatagaagctgcttttgaacaaagaatcagtctttca
gctactggatacttcaggggctacaaggccttcatggactgggagaagggagagggagac
cctttcccctactatgtctatggagctgcctgttctgaggttgaaattgactgcctgaca
ggagctcacaaaaaaatcagaacagacatcgtcatggatgcctgctgcagtctaaatccg
gccatcgatattgggcagattgaaggtgcgtttattcagggaatgggcctttataccact
gaagagctgaaatattccccagaaggtgtcctgtactctcgaggcccagatgagtacaaa
attccaaccatcagcgatgtcccagaggaatttaatgtctccttgttgccatcatcacaa
actccactaaccatctattcatccaagggcctgggggagtctgggatgttcctggggtca
tccgtgttctttgccatcactgatgctgtggctgcagctcgcaaagaaagagacatagct
gaggatttcacagtgaagagcccagcgactccagaatgggttcgaatggcctgtgcagat
cggttcacagaaatgatcccaagagatgatcctaagacatttaaaccctggtctatcaca
gtagcataa

DBGET integrated database retrieval system