KEGG   Bos taurus (cow): 532512Help
Entry
532512            CDS       T01008                                 

Gene name
POR, P450R
Definition
P450 (cytochrome) oxidoreductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     532512 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
25
AA seq 680 aa AA seqDB search
MNMADSNMDAGTTTSEMVAEEVSLFSTTDVILFSLIVGVMTYWFLFRKKKEEVPEFTKIQ
TTTSSVKDRSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYD
LADLSSLPEIEKALAIFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKYAVFALGNKTY
EHFNAMGKYVDKRLEQLGAQRIFDLGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGE
ESSIRQYELMVHTDMDMAKVYTGEMGRLKSYENQKPPFDAKNPFLAVVTTNRKLNQGTER
HLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGEILGADLDIIMSLNNLDEESNKK
HPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPTEHEQLRKMASSSGEGKELYLR
WVLEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEY
ETKTGRINKGVATSWLRAKEPAGENGGRALVPMYVRKSQFRLPFKATTPVIMVGPGTGVA
PFIGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAGFHKDGALTQLNVAFSRE
QPQKVYVQHLLKKDKEHLWKLIHEGGAHIYVCGDARNMARDVQNTFYDIVAEQGAMEHAQ
AVDYVKKLMTKGRYSLDVWS
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggcagactccaacatggatgccggcaccaccacgtctgagatggtggctgaa
gaagtgtcccttttcagcacgacggacgtgatcctgttttctctcatcgtgggtgtcatg
acatactggttcctcttcaggaagaaaaaagaagaagtccccgagttcaccaagattcag
accacgacctcctctgtcaaagacagaagcttcgtggagaagatgaagaagacgggcagg
aacatcatcgtgttctacggctcccagacggggactgctgaggagtttgccaaccgcctg
tccaaggacgcccaccgctatgggatgcggggcatggcagctgaccccgaggagtatgac
ctggccgacctgagcagcctaccagagattgagaaagccttggccatattctgcatggcc
acctacggcgagggggaccccaccgacaatgcccaggacttctacgactggctccaggag
acggacgtggacctctctggggtcaagtacgcggtgtttgcccttgggaacaagacatac
gagcatttcaacgccatgggcaagtacgtggacaagcggctggaacagctcggggcccag
cgaatctttgatctggggctgggcgacgatgacgggaacctggaggaggacttcatcaca
tggcgagagcagttctggccagccgtgtgcgagcacttcggggtggaagccactggagag
gagtccagcattcgccagtacgaactcatggtccacacagacatggacatggccaaggtg
tacacgggcgagatgggccgcctgaagagctacgagaaccagaaaccccccttcgacgcc
aagaacccattcctggctgttgtcaccaccaaccggaagctgaaccagggaaccgagcgg
cacctcatgcacctggaattagacatctcggactccaaaatcaggtatgagtctggggac
catgtggctgtttatccggctaatgactctgccctggtgaaccagcttggcgagatcctg
ggtgccgacttggacatcatcatgtccctgaacaaccttgatgaggagtccaacaagaag
caccccttcccctgccccacctcctaccgcacggccctcacctactacctggacatcacc
aacccgccacgcaccaacgtgctctacgagctggcgcagtacgcctcggagcccaccgag
cacgagcagctgcgcaagatggcctcctcgtcaggcgagggcaaggagctatacctgagg
tgggtgctggaggctcggcggcacatcctggccatcctgcaggactacccgtccctgcgg
ccccccatcgaccacctgtgcgagctgctgcctcgtctccaggcccgctactactccatc
gcctcatcctccaaggtccaccccaactccgtgcacatctgcgccgtggccgtggagtac
gaaaccaagacgggccgcatcaacaagggcgtggccaccagctggttgcgggccaaggaa
ccggccggggagaacggcggccgggccctggtgcccatgtacgtgcgcaagtcccagttc
cgcttgcccttcaaggccaccacgcccgttatcatggtgggccctggcactggggtcgcc
cccttcataggcttcatccaggagcgggcgtggctgaggcagcagggcaaggaggtgggc
gagacgctgctctactacggctgccggcgctctgacgaggactacctgtaccgcgaggag
ctggccggtttccacaaggacggcgccctcacccagctcaacgtggccttctctcgggag
cagccgcagaaggtatacgtgcagcacttactcaagaaggacaaggagcacctgtggaaa
ctcatccacgaggggggcgcccacatctacgtgtgcggggacgctcggaacatggcgagg
gacgtgcagaacaccttctacgacatcgtggccgagcagggggccatggagcacgcccag
gccgtggactacgtcaagaagctgatgaccaagggccgctactccctggacgtatggagc
tag

DBGET integrated database retrieval system