KEGG   Bos taurus (cow): 532572Help
Entry
532572            CDS       T01008                                 

Gene name
LAMC1
Definition
laminin, gamma 1 (formerly LAMB2)
Orthology
K05635  
laminin, gamma 1
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    532572 (LAMC1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    532572 (LAMC1)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    532572 (LAMC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    532572 (LAMC1)
   05222 Small cell lung cancer
    532572 (LAMC1)
  Neurodegenerative diseases
   05020 Prion diseases
    532572 (LAMC1)
  Infectious diseases
   05146 Amoebiasis
    532572 (LAMC1)
   05145 Toxoplasmosis
    532572 (LAMC1)
Cell adhesion molecules and their ligands [BR:bta04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      532572 (LAMC1)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      532572 (LAMC1)
     Laminin-2 Extracellular matrix (ECM) components
      532572 (LAMC1)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      532572 (LAMC1)
   VLA-3
      532572 (LAMC1)
     Laminin-10 Extracellular matrix (ECM) components
      532572 (LAMC1)
     Laminin-11 Extracellular matrix (ECM) components
      532572 (LAMC1)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      532572 (LAMC1)
     Laminin-8 Extracellular matrix (ECM) components
      532572 (LAMC1)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      532572 (LAMC1)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      532572 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
16q22-q24
AA seq 1608 aa AA seqDB search
MRGSDRAAAALRPRGRVWPVLVVLAAAAAGCARAAMDECTDEGGRPQRCMPEFVNAAFNV
TVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGS
CENTYSKATRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFD
KLVCNCKHNTYGVDCEKCLPFFNDRPWRKATAESASECHPCDCNGRSQECYFDPELYRST
GHGGHCTNCQDNTDGAKCERCRENFFRLGNREACSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGYHSLTEAGCRPCSCNPSGSIDECNIETGRCVCKDNVEGFNCERCKPGF
FNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSITSTFETDEDGWRAKQMDGSEASFEWS
SERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNFSFSFRVDRRDTRLSAEDLVLEGAG
MRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYS
ERSAGYLDDVTLASAHPGPGVPATWVESCTCPVGYGGQFCEVCLSGYRRETPSLGPYSPC
VLCTCNGHSETCDPESGVCNCRDNTAGPNCEKCSDGYYGDSTAGTSLDCQPCPCPGGSSC
AVVPKTQEVVCTNCPTGTTGRRCELCDDGHFGDPLGSNGPVRLCRLCQCNDNIDPNAVGN
CNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACDCNPYGTVKQQSSCNPV
TGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDVHSGQCECQPGIT
GQHCEHCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFY
NRSWPGCQECPACYRLVKDKVADHRAKLRELENLIANLGTGDEMVTDQAFEDRLKEVERE
VTDLLREAQDVKDVDQNLMDRLQRVNNTLFSQISRLQNIRNTIEETGNLAEQARSRVEST
EQLIEIASRELEKAKVAIANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVA
KTANDTSAEAYNLLLRTLAGENQTASEIEELNRKYEQAKNISQDLEKQAARVHEEAKKAG
DKAVEIYASVAQLTPVDSEALENEANKIKKEAEDLDRLIDQKLKDYEDLRDDMRGKEFEV
KKLLEKGKTEQQTADQLLARADAAKALAEEAAEKGRNTLQEANDILNNLKDFDRRVNDNK
TAAEEALRRIPAINQTIIEANEKTREAQQALGNAAADATEARNKAHEAERIASAVQKNAT
STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKKKQEDADQDMMMAGMASQAAQEAEI
NARKAKNSVTNLLNLINDLLEQLGQLDTVDLNKLNEIEGTLNKAKEEMKVSDLDRKVSNL
ENEARKQEAAIMDYNRDIEEILKDIRNLEDIKKTLPSGCFNTPSIEKP
NT seq 4827 nt NT seq  +upstreamnt  +downstreamnt
atgaggggcagcgaccgggccgcggcggcgttgcggccgcggggccgcgtctggccggtg
ttggtcgtgctggcggccgccgcggccggctgcgcccgggcagccatggacgagtgcacg
gacgagggcgggcggccgcagcgctgcatgcccgagttcgtcaacgccgccttcaacgtg
accgtggtggccaccaacacgtgcgggactccgcccgaggagtactgcgtgcagaccggg
gtgaccggggtcaccaagtcctgtcacctgtgcgacgcagggcagccccacctgcagcac
ggggcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcagagccag
accatgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaa
gcgtttgacatcacgtatgtgcgcctcaagttccacaccagccgcccggagagcttcgcc
atttacaagcgcacgcgggaagacgggccctggatcccttaccagtactacagcggctcc
tgcgagaacacctactcgaaggcaacccgcggcttcatccggacgggcggcgacgagcag
caggcgttgtgcacagatgagttcagcgacatctctcctctcactgggggcaacgtggcc
ttttccaccctggaaggaaggcccagcgcctacaacttcgacaacagccctgtgctgcag
gaatgggtaactgccactgacatcagagtaactctcaatcgcctgaacacttttggagat
gaagtgtttaatgaccccaaagttctcaaatcctattattatgcaatctctgattttgct
gtgggtggtaggtgtaaatgtaacggacatgcaagcgagtgtgtaaagaacgagtttgac
aagctggtgtgtaattgcaaacataatacttatggtgtggactgtgaaaagtgccttcct
ttcttcaacgaccggccgtggaggaaggcgaccgccgagagtgccagcgagtgccatccc
tgtgactgcaatggccgatctcaggaatgctactttgaccctgaactataccgttccacg
ggccatggtggccactgtaccaactgccaggacaacacagacggtgccaagtgtgagagg
tgccgggagaatttcttccgccttgggaacagggaagcctgctctccctgccactgtagt
cctgttggttccctcagtacacagtgtgatagctatggcagatgtagctgtaagccggga
gtgatgggggacaagtgtgaccgttgccagcctgggtaccattctctcactgaggctggg
tgcaggccatgctcttgcaatccttctggcagcatagatgaatgtaatattgaaacagga
agatgtgtttgcaaagacaatgtcgaaggcttcaattgtgagagatgcaaacctggattt
tttaatctggaatcatctaaccctagagggtgcaccccctgcttctgctttgggcattct
tccgtgtgcacaaatgccgttggctacagcgtttattctataacctctacctttgagact
gatgaggatgggtggcgtgcaaaacaaatggatggctctgaagcatcatttgagtggtcc
tctgagaggcaggatattgccgtcatctcagacagctactttcctcggtacttcattgcc
cctgcaaagttcttgggcaagcaggtgttgagttatggtcagaatttctccttctccttc
cgcgtggacaggcgagacactcgcctctcggcagaagacctggtgcttgaaggagctggc
atgagagtgtctgtgcccttgattgctcagggcaattcctatccaagtgagaccactgtc
aaatatgtcttcaggctccatgaagcgacagattacccttggaggcctactcttacccct
ttcgaatttcagaaactcctgaacaatttgacctctatcaagattcgtgggacatacagt
gagagaagtgctggctatttggatgatgtcaccctggcaagcgctcatcctgggcccggg
gtccccgcaacttgggtggagtcctgcacgtgtcccgtgggatacggagggcagttttgt
gaggtgtgcctctcgggttaccgaagagaaacgccgagcctcggcccgtacagtccctgt
gtgctctgcacctgcaatgggcacagcgagacctgcgaccctgagtcaggtgtttgtaac
tgcagagacaacacggccgggcccaactgtgagaaatgcagcgatggctactatggcgat
tcaaccgcaggcacctccttggattgccagccctgtccgtgtcctgggggctccagctgt
gctgttgtccctaagacacaggaggtggtgtgcaccaactgtcctaccgggactaccggt
agaaggtgtgagctctgtgatgacggccactttggagaccctctgggtagcaacggcccc
gtgaggctttgccgcctgtgtcagtgcaatgacaacatcgatcccaacgctgttgggaat
tgcaaccgcctgacgggagaatgcctgaagtgcatctataacacggccggcttctactgt
gaccggtgcaaagatggattttttggaaatcccctggctcccaatccagcagacaaatgc
aaagcctgtgactgcaacccctacgggacggtgaagcagcagagcagctgtaaccctgtg
accgggcagtgcgagtgtctgccccacgtgaccggccgggactgcggcgcttgtgacccc
ggattctacaacctgcagagcgggcagggctgtgagaggtgtgactgccacgctttgggt
tccaccaacggacagtgtgacgtccacagcggccagtgtgagtgccagcctggcatcacc
ggtcagcactgtgagcactgcgaggtcaaccactttgggtttggacccgaaggctgcaaa
ccctgtgactgtcatcctgaggggtctctttccctccagtgcaaagacgatggtcgctgt
gaatgcagagaaggctttgtggggaatcgctgtgaccagtgtgaagagaactatttctac
aatcggtcttggcctggctgccaggaatgtccagcttgttaccggctggtgaaggataag
gttgctgatcaccgagccaaactccgggaattagagaatctcattgcaaaccttggaact
ggggatgagatggtgacagatcaagcctttgaggataggctaaaggaagtagagagggaa
gttactgacctccttcgtgaagcccaggatgtcaaagatgtagaccaaaatttgatggat
cgcctccagagagtgaataacaccttattcagccaaattagccgtttacagaatatccgg
aataccattgaagagaccggaaacttggctgaacaagcacgttcccgggtcgaaagcaca
gagcagttgattgaaatcgcatccagagaacttgagaaagcaaaggtcgccattgccaat
gtgtcagtcactcagccagagtctacaggagaccccaacaacatgacccttttggcagaa
gaggcacggaagcttgctgaacgccataaacaagaagctgatgacattgtacgagtagcg
aagacagcgaatgatacctcagctgaggcatacaatctgcttttgaggacactagcagga
gaaaatcaaacagcatctgagattgaagagcttaatagaaagtacgaacaagcgaagaac
atctcccaggatctagagaagcaagctgcccgagtacacgaggaggccaagaaggctggt
gataaagcggtggagatctatgccagtgtagcccagctcactcctgtggattcggaagca
ctggagaatgaggcaaataaaatcaagaaggaagctgaagatctggaccgtctgattgac
cagaagttgaaagattacgaggacctcagagatgacatgagaggcaaagaatttgaagta
aagaaacttctggagaaaggaaagactgaacagcagactgctgaccagctccttgcccga
gctgatgctgccaaggcccttgcggaagaagctgccgaaaagggacgaaacaccttacaa
gaagccaatgacattctcaacaacctgaaagattttgataggcgagtgaatgataacaag
acggctgcagaggaggccctaaggagaatccctgccatcaaccagaccataattgaagcc
aatgaaaagaccagggaagctcagcaggcgctgggcaatgccgccgcagatgccaccgag
gccaggaacaaggcccacgaggcggagaggattgccagcgccgtccagaagaacgctacc
agcaccaaggcagaagctgaaaggacttttgcagaagttacagatctggataacgaggtg
aataatatgttgaaacaactacaggaagcagaaaaagagctgaagaaaaaacaagaagat
gctgaccaggatatgatgatggcagggatggcttcacaggcagctcaggaagccgagatc
aatgccagaaaagccaaaaactctgttaccaaccttctcaaccttattaatgacctcctg
gagcagcttgggcagctggacacagtggacctgaacaagctaaatgagattgaaggcacc
ctgaacaaagccaaagaagaaatgaaagtcagtgatctagacaggaaggtgtccaacctg
gagaacgaagccaggaagcaggaggctgccatcatggactataaccgagacatcgaggag
atcctgaaggacattcgcaacctggaagacatcaagaagaccctaccctccggctgcttc
aacaccccgtccattgagaagccctag

DBGET integrated database retrieval system