KEGG   Bos taurus (cow): 532672Help
Entry
532672            CDS       T01008                                 

Gene name
STAMBP
Definition
STAM binding protein (EC:3.1.2.15)
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    532672 (STAMBP)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     532672 (STAMBP)
Peptidases [BR:bta01002]
 Metallo Peptidases
  Family M67
   532672 (STAMBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
11
AA seq 423 aa AA seqDB search
MSDHGDVSLPPEDRVRALSHRGSAVEINEDIPPRRYFRSGVEIIRMASVYCEEGNIEYAF
ILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYLE
YNEEKKKEAEEFARNVAMQEELEKERRRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLK
IVQEFGKVDPGLGGPLVPDLETPSLDVFPTVPAIPTQPSDCNAAVRLAKPPVVDRSLKPG
ALNNLEAPTIDGLRHVVVPGKLCPQFLQLAGANTTRGVETCGILCGKLMRNEFTITHVLI
PKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPE
SIAIVCSPKFQETGFFRLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTVT
DLR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccatggagatgtgagcctcccacccgaagaccgggtgagggccctgtcccac
aggggcagcgccgtggagataaatgaagacattccaccccgccggtacttccgctccgga
gtggagattatccggatggcgtctgtttactgtgaggaaggcaacatcgaatatgccttc
atcctctataacaagtatatcacgctctttattgagaaactaccaaagcatcgagattac
aaatcagctgtcattcctgaaaagaaagacacagtaaagaaattaaaggagattgcattt
cccaaagcagaagaactgaaggcagaactgttaaaacgatataccaaagaatatttagaa
tataatgaagaaaaaaagaaggaagcggaagaatttgcccgaaatgtagccatgcaggaa
gagctggaaaaggaaagacggagggtggcccagcagaagcagcagcagttggagcaggag
cagttccatgccttcgaggagatgatccggaaccaggagctagaaaaggaacgactgaag
attgtgcaggagtttgggaaggtggaccctggcctggggggcccactggtgcctgacttg
gagacgccctccctagatgtgttccccacggtgcctgctatacccacacagccttcagac
tgtaatgcagctgtgaggcttgccaagccaccggtggtggacagatccttgaaacctgga
gcactgaacaacttggaagctcctacaatcgatggattgcgccacgtggtggtgcccggg
aagctctgcccacagtttctccagttggccggtgccaacactacccggggagtggagaca
tgtggaattctctgtggaaaactgatgaggaacgaatttaccattacccacgttctcatc
cccaagcagagtgctgggtctgattattgcaacaccgagaatgaagaagagcttttcctc
atacaggatcagcagggtctcatcacactgggctggattcatactcatcccacgcagaca
gccttcctctccagtgttgacctacacactcactgctcgtaccagatgatgttgccagag
tcgatagccattgtttgttcccccaaattccaggaaactggattctttagactcactgac
catggactagaggagatttcttcctgtcgccagaaaggatttcatccccacagcaaggac
ccacccctcttctgtagctgcagccatgtgactgttgtggacagagctgtgaccgtcaca
gaccttcgatga

DBGET integrated database retrieval system