KEGG   Bos taurus (cow): 532721Help
Entry
532721            CDS       T01008                                 

Gene name
USP42
Definition
ubiquitin specific peptidase 42 (EC:3.4.19.12)
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     532721 (USP42)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   532721 (USP42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
25
AA seq 1325 aa AA seqDB search
MTIVDKASESSDPSTYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGA
VVYSSSSVPEKSKPSPQKDQALGDGIAPPQKVLFPSEKICLKWQQTHRVGAGLQNLGNTC
FANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQAHITQALSNPGDVIKPMFVI
NEMRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQATTLVCQIFGGYLRS
RVKCLNCKGVSDTFDPYLDITLEIKAAQSVNKALEQFVKPEQLDGENSYKCSKCKKMVPA
SKRFTIHRSSNVLTLSLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIIYVLYAVL
VHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLSQQAYVLFYIRSHDVKNGGE
LTHSAHSPGQSSPRPVISQRVVNSKQAASGFIGPQLPSHMMKNPPHLNGTGPLKETPSSP
MSGPSGNSSVSRTGPVSASPSVQNWSVNRPSVIPEHPKKQKITISIHNKLPVRQGQSQSN
LHSNSLEHPNKPAPSSTITTSSAIQSTSSAPTPPASSKVPKQMAPREACSRPMMNGRPRL
SAGVLVPYGAESSEESDEEAKGLGQENGRGLTESACSPALDAEDGDASPHELQEPVALNG
ATGLDSDPTENGLPSDGAPCPGQPALHSEHPFPKANGLPGKLMPAPLPPLPEDKILETFK
LGSKAKGSAEETRTPGSEERPLEHPEAELEAGRSPPGDARDNLESVSNLSSKFKKASPPS
DPSIKPTKEEVSERVSAEPEEAVPSASTFCNPDKDALGDDQLLAPCDPGNLTDDQSKPSP
DVGGTLPERPQDPVAAEAAGRLSPGPSVPSEGDHEPEPLGHSGRDRGSDAEGPSKSMGVS
TDEAPSAQLDTITENRPEGPPERSSSERGEDSKAGQKAPEPCLVQEKVSSLRKVDRGHYR
SRRDRSSSGEHARESRSRTEVQHRRKRPHREHERPRPERPRPEPCALAPQPPCPSSLARS
GHHHSRSRGAPDQEWGRYHHAEGDHAWTREKYYPDRLRWERCRYHHDRSPLYPSREPRDW
RPFHAEREYERAGPYGGRPYKDHYRGRKGYELVAKERDRHRFSSPRAGMAHAPPPHPAAK
YTHDRLSFGAEDGSCDLAARFHEHDNIKSRKRRYDSLENESHVEKKAWRSLQKDPVEEPK
VKKHKKSKKKKKSKDKHRDRDSRHQQDSDLSVAHSDADLHRHKKKKKKKKRHSRKSEDFG
RDSEPRLPKAASCETVDHFRKAEGAFPLADGLPLEGAAPFCEKTKHFRMESREVRCRLSQ
CDQGD
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagttgacaaagcttctgaatcttcagacccatcaacctatcagaaccagcct
ggcagttctgaggctgtctcacctggagacatggatgcaggttctgccagctggggtgct
gtgtcttcgttaaatgatgtttcaaatcacacactttctttaggaccagtacctggtgct
gtagtttattcaagttcatctgtacctgaaaaatcaaaaccatcaccacaaaaggatcaa
gccctaggtgatggcattgctcctccacaaaaagttctcttcccatctgagaagatctgt
cttaagtggcagcagactcacagagtaggagctgggctccagaacttgggcaatacctgt
tttgcaaacgcagcactgcagtgtctaacttacacgccgcctctcgccaactacatgcta
tcacacgagcactccaagacatgtcatgcagaaggattttgcatgatgtgtacaatgcaa
gcacatatcacccaggcactcagtaatcctggggatgttattaaaccgatgtttgtcatt
aatgagatgcggcgcatagccaggcacttccgctttggaaaccaagaagacgcccacgaa
ttccttcagtacactgttgatgctatgcaaaaagcatgtttgaacggcagcaataaattg
gacagacacacccaggccaccacactcgtctgccagatatttggaggctacctaagatct
agagtcaaatgtttaaattgcaaaggtgtttcagatacttttgatccctatctcgatata
actttggagataaaggctgctcagagtgtcaacaaggccttggagcagtttgtaaagccg
gaacagctcgacggagaaaactcgtacaagtgcagcaagtgtaaaaagatggttccagct
tcaaagagattcactatacatagatcttctaatgttcttactctttctctgaaacgtttt
gcaaattttactggtggaaaaattgctaaggatgtgaaataccctgagtatcttgatatt
cgaccgtacatgtctcaaccaaacggagagccgatcatttatgttttgtatgcagtcctg
gtacacactggttttaattgccatgctggccattacttctgctacataaaagctagcaac
ggcctctggtaccaaatgaacgactccatcgtgtctaccagtgatatcagatcggtactc
agccagcaagcttacgtcctcttttatatcaggtcccacgatgtgaaaaatggaggcgaa
cttactcattccgcccacagccccggccagtcctcgccccgcccggtcatcagtcagcgg
gttgtcaacagcaaacaggcagcctcgggattcattggcccacagctcccctcgcacatg
atgaagaacccccctcacctgaacgggacgggaccactgaaggagacgccgagcagcccc
atgtcaggccccagcgggaactccagcgtcagcaggactggtcctgtgagcgcctccccg
tctgttcagaactggtcagttaacaggccctcagttattccagaacaccccaagaaacag
aaaatcacgatcagtattcacaacaagttacctgtgcgccaaggtcagtctcagtctaac
cttcacagcaattctttggagcaccccaacaagcccgccccctcttctaccattaccact
tcttctgcaatacagtctacctcgagtgcccccacgccgcccgcctctagtaaggtccca
aagcagatggccccgagggaggcctgctccaggcccatgatgaacggcaggcccaggctg
agcgctggcgtgctggtcccctacggcgccgagtcctccgaggagtctgacgaggaggcc
aagggcctcggccaggagaacggccgcgggctgaccgagagcgcgtgctcccctgctctg
gacgctgaagacggcgacgcctccccgcacgagctccaagaacctgtggctctaaatggt
gctactggtctggacagcgacccgacggaaaacggcctgccctcggacggggccccttgc
ccaggccagcccgcgctgcactcagaacacccctttcccaaggcaaatggcctccctggg
aagttgatgcctgctcctttgccacctcttccagaagacaaaatcttagagaccttcaaa
ctcggcagcaaagccaaaggctcggcagaggagactaggacacctggctcagaggagagg
cctctggagcatccggaggcggagctggaggctggccgttcccctcccggtgatgcccgg
gacaacctggagtctgtctcgaatctcagcagcaaattcaagaaggcttcgccgccctcg
gaccccagcatcaaacctaccaaagaagaagtctctgaacgtgtttcggcagaacctgag
gaggctgtaccgagtgccagcaccttttgtaaccccgacaaggacgccctcggggacgat
cagcttttggcaccctgtgaccctgggaatttaacagacgatcagagcaaaccgtccccg
gacgtgggagggacgttaccagagcggccccaggacccggtggccgcggaagccgcaggg
aggctgagcccaggtccctctgtgccttctgagggtgaccatgagcccgagcccttgggt
cacagcggtcgggacagaggctcggatgcggagggtccctctaagagcatgggggtgtcc
acagatgaggcgccttctgcgcagctagacacgatcacagaaaaccgtcctgaggggccc
cccgagcgcagcagcagtgagagaggggaagacagtaaggccgggcagaaggccccggag
ccgtgtctggtccaggagaaggtcagcagcctgagaaaggtcgaccgaggacattaccgc
agccgaagggaccgctcgtccagtggcgagcatgcacgggagagccggagcaggaccgag
gtgcagcatcggcggaagcggccccaccgggagcacgagcggccgcggcctgagcggccc
cggccggagccctgcgccctggccccgcagcccccctgccccagctccctggccaggtca
ggccaccaccactcccggagcaggggcgcccctgaccaggagtggggccgctaccaccac
gccgagggcgaccatgcctggacccgggagaagtactacccggacaggctgcgctgggag
cgctgccggtaccatcacgacaggtcccccctgtatcccagccgggagccccgggactgg
cggcccttccacgccgagcgagagtacgagcgggccgggccctatggcggccggccttac
aaggaccactacagaggccgcaagggctacgagctggtggccaaagagagggaccggcac
cgcttcagcagcccccgggcgggcatggcccacgcgccccctccacaccctgccgccaag
tacacccacgacaggctcagcttcggggctgaagacggcagctgcgacctggccgcacgg
tttcacgaacatgacaacattaagtcacggaaacggagatacgatagcctcgagaatgag
agtcacgtagaaaagaaagcctggagaagcttacagaaggaccctgtagaggagcccaaa
gtgaagaagcacaaaaagtcgaagaagaagaagaaatccaaagacaaacaccgggaccga
gactccaggcatcagcaggattcagacctttccgtagcgcactctgacgctgacctccac
agacacaagaagaagaagaagaaaaagaagagacactcgaggaaatcagaggactttggg
cgagattcagaaccgcgcttgcccaaggcagccagctgtgagactgtggaccatttccgg
aaagccgagggcgccttccccctcgcagacggcctgccgctggagggcgcggcacccttc
tgtgagaaaaccaaacacttcaggatggagagccgggaggtcaggtgtcgtctgtcccag
tgcgaccagggtgattga

DBGET integrated database retrieval system