KEGG   Bos taurus (cow): 532742Help
Entry
532742            CDS       T01008                                 

Gene name
GLA
Definition
galactosidase, alpha (EC:3.2.1.22)
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
bta  Bos taurus (cow)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bta00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bta00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bta00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:bta00603]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bta04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
X
AA seq 439 aa AA seqDB search
MMTATMKPVSRVLRLGCVLAFCFQVLVPYGLPRAWGLDNGLAMTPTMGWLHWERFMCNVN
CQEEPDSCISEKLFLQIAEIMASDGWKDVGYEYICIDDCWMAPERDSKGRLQADPKRFPG
GIHRLADYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCD
SIQHLAEGYKQMSLALNRTGRSIVYSCEWPLYVWPIFKPNYTEIREYCNHWRNFADIYDS
WESIRKTLDWTSSNQKIIVPVAGPGGWNDPDMLVIGNFGLSRDQQITQMALWAIMAAPLL
MSNDLRHISPEAKALLQDKDVIAINQDRLGKQGYWLRKEDNFEMWERPLLNLAWAVAIVN
LQEIGGPRSYTISVTSLGRGLACNPNCLITELLPEKRKLGIYEWTSTLKTQINPTGTVLL
RLETTSSAQFSHSVVSDFL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagcgacgatgaaaccggtgagcagagtcctgcggctgggctgcgtgctggcc
ttttgcttccaggtcctggttccctacgggctccctagggcttggggcctggacaacggc
ttggcgatgacccctaccatgggctggctgcactgggagcgcttcatgtgcaacgtgaac
tgccaagaagagccggattcctgtatcagcgagaagctcttcctgcagatagctgagatc
atggcctcagatggctggaaggatgtaggttatgagtacatctgcattgatgactgttgg
atggctccggaaagagattcaaaaggcagacttcaggcagaccctaaacgctttcctggt
gggatccaccgcctggctgattatgttcatagcaaaggactgaagctagggatttatgca
gatgttggaaataaaacctgcgcaggcttccctgggagttttggatactatgacattgat
gcccagaccttcgctgactggggagtagatctgctaaaatttgatggttgttactgtgac
agtatacaacatttggcagagggttataagcaaatgtccttggccctgaacaggactggc
agaagcattgtgtattcctgtgagtggcccctttatgtgtggcccatctttaagcccaat
tacacagaaatccgagagtactgcaatcactggagaaattttgctgacatttatgattct
tgggaaagtataaggaaaaccttggactggacatcttctaaccagaagataattgttcct
gttgcaggaccaggaggttggaatgacccagatatgttggtgattggcaactttggcctc
agccgggatcagcaaataactcagatggccctctgggctatcatggcggctccgttactc
atgtccaatgatctccgacacatcagccctgaagccaaagcccttcttcaggataaggat
gtaattgccatcaaccaggaccgcttaggcaaacagggttactggcttagaaaggaggac
aactttgagatgtgggaacgccctctcttgaacttagcatgggctgtggctatagtaaac
ctgcaagagattggtggacctcgttcttacaccatctctgttacttccttgggtcgagga
ctggcctgcaatcccaactgcctgatcacagaactcctgcctgagaagaggaagcttggg
atttatgaatggacttcaactttaaaaactcaaataaatcccacaggcacggttttgctt
aggctagaaacaacaagctcagctcagttcagtcactcagttgtgtctgactttttgtga

DBGET integrated database retrieval system