KEGG   Bos taurus (cow): 532797Help
Entry
532797            CDS       T01008                                 

Gene name
IMPAD1
Definition
inositol monophosphatase domain containing 1 (EC:3.1.3.7 3.1.3.25)
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
bta  Bos taurus (cow)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bta00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bta00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:bta04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
14
AA seq 362 aa AA seqDB search
MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLGGEPGGGAAGPAGPAASAD
GGTVDLREMLAVSVLAAVRGGEEVRRVRESNVLHEKSKGKTREGADDKMTSGDVLSNRKM
FYLLKTAFPSVQINTEEHVDASDQEVILWDRKIPEDILKEIATPQEVPAESVTVWIDPLD
ATQEYTEDLRKYVTTMVCVAVNGKPVLGVIHKPFSEYTAWAMVDGGSNVKARTSYNEKTP
RIVVSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIK
KWDICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTG
HK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcccccatgggcatccgcctgtccccgctgggggtggccgtgttctgcctgctgggg
ctcggcgtgctctaccacctctattcaggcttcctggccggccgcttcagcctctttggc
ctgggcggcgagccgggcggcggggcggcggggcccgcggggcccgcggcctcggccgac
gggggcacggtggacctgcgcgagatgctggccgtatcggtgctggcggccgtgcgcggc
ggcgaggaggtgcggcgcgtacgcgagagcaacgtcctccacgagaagtccaaggggaag
acgcgcgagggagcggacgacaagatgaccagtggagacgtgttgtccaaccgcaagatg
ttctacctactcaagaccgccttccccagcgtgcagatcaatacggaggaacatgtggat
gcatctgatcaagaggtgatcttgtgggatcggaagattcctgaggacatcctaaaggaa
atagccactccccaggaagtgccggcagagagcgtcaccgtctggattgacccactggat
gccacacaggagtacacggaggatcttcggaagtatgttactactatggtgtgtgtggct
gtaaatggtaaacctgtgctaggagtaatacataaaccattttctgaatatacagcctgg
gcgatggtagacggtggatcaaatgtgaaagcccgcacttcttacaatgagaagacccca
aggattgtcgtgtctcgctcgcattcaggaatggtcaaacaggttgctcttcagactttc
ggaaaccagactacgatcatcccagcgggcggtgctggttataaagttttagcactcttg
gatgtgcctgataagagtcaagaaaaagctgatctatatatccatgtgacatacatcaaa
aagtgggatatctgtgctggcaacgccatcttgaaagccctcggggggcacatgaccacc
ctgagtggtgaagaaattagctacactggttccgacggcattgaaggggggctcctggcc
agcatcaggatgaaccatcaggctctggtcagaaagctcccggatctggagaagacggga
cataagtaa

DBGET integrated database retrieval system