KEGG   Bos taurus (cow): 533103Help
Entry
533103            CDS       T01008                                 

Gene name
SPHK2
Definition
sphingosine kinase 2
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
bta  Bos taurus (cow)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    533103 (SPHK2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    533103 (SPHK2)
   04020 Calcium signaling pathway
    533103 (SPHK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    533103 (SPHK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    533103 (SPHK2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     533103 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
18
AA seq 612 aa AA seqDB search
MNGNLEAEERQDQRPEQELTWSWGYRPRSALDRVKAMAPPPPLAPSTPLLHGEFGSYPDR
GPRFALTLTPQALHIQRLRPKPEARPRGGLVLLTEVSGCCTLRSRSPLDSAAYFCVYTYP
RGRRGARRRAARTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRPP
RLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLNLSEWDGI
VTVSGDGLLYEVLNGLLQRPDWEEAVKTPVGILPCGSGNALAGAVNRHGGFEPALGIDLL
LNCSLLLCRGGSHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTLG
TVLGLATLHTYRGRFSYLPATVEPASPAPAHGLPRAKSELTLAPAPAPPVAHSPLHRSVS
DLPLPLPQPALTSPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLPSPPGTPKAA
QLSPISEGASEMAASSGLPPPTPGAPVSISAGGPPDHLLPPLGTPIPPGWVTMEGDFVLI
LAILPSHLGADLVAAPHARFDDGXVHLCWVRSGISRAALLRMFLGHGAWYPLQPGCPYLG
YAAAHAFQSQVG
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaaccttgaagcagaggagcggcaggaccagaggccagagcaggagctgacc
tggagctggggctaccggcctagaagcgccctggacagggtcaaggccatggccccccca
ccgccactggcccccagcaccccactcctgcatggcgagtttggctcctacccagaccgc
ggcccacgcttcgccctcactctcacaccacaagccctgcacatacagcggttgcgccca
aagcccgaggcccggccccggggtggcctggtcctgctgaccgaggtctcaggctgctgc
accctgcggagccgaagccccctggactcagcagcctacttctgcgtctacacctacccc
aggggccggcgcggggcccggcgcagagctgcacgcaccttccgggccgacggggcagcc
acctacgaggagaaccgcgctgaggcccagcgctgggccactgccctcacgtgtctgctc
cgtggactgccactgcctggggacggggaaatcaccccggacctcctgcctaggccgccc
cgattgctcctattggtcaatccctttggggggcggggcctggcctggcagtggtgtaag
aaccatgtgctgcccatgatctccgaagcggggctgtccttcaacctgatccagacagaa
cgacagaaccatgcccgtgagctggtccaggggctgaacctgagcgaatgggacggcatc
gtcacagtctcgggagatgggctgctgtatgaggtgctgaatggactcctacaacgcccc
gactgggaagaggctgtgaagacccccgtgggcattctcccctgtggctcgggcaatgcg
ttagcaggagccgtgaaccggcatgggggatttgagcctgccctgggcattgacctgcta
ctcaactgctccttactgctctgccggggtggcagccacccgctggacctgctctccgtg
actctggcctccggctcccgctgtttctctttcctgtctgtggcctggggcttcgtgtca
gatgtggacatccagagcgagcgcttcagggccctgggcagtgctcgcttcacgctgggc
acagtcctgggccttgccacgctgcacacctaccgcggccgcttctcctacctccctgcc
actgtggaacccgcctcgcctgcccctgcccatggcctgccaagggccaagtcagagttg
accctggccccggccccagccccacccgtggcccactcacccctgcatcgctcagtgtca
gacctgcccctgcccctgcctcagcctgccctgacctcccctggctcacctgaacccctg
cccatcctgtctctcaacggtgggggcccagagctggctggggactggggtggggctggg
gatgccccactctccccggacccactgctgccctcgcccccggggacccccaaggcagct
cagctctcacccatcagcgagggggcctcagaaatggcagcatcctctgggctcccacct
cccacccctggtgccccagtatccatctctgctgggggaccacctgatcacctgctccct
cctctaggcactccgatacccccaggctgggtgacgatggagggagactttgtgcttatt
ttggccatcttacccagccacctgggggctgacctcgtggcggccccccacgcgcgcttt
gacgacggcnctgtgcacctgtgctgggttcgcagcggcatctcgcgggcggcgctactg
cgcatgtttctgggccatggagcgtggtacccacttcagcctggctgtccgtacctgggc
tacgccgcagctcatgccttccaaagccaggtcggctga

DBGET integrated database retrieval system