KEGG   Bos taurus (cow): 533103Help
Entry
533103            CDS       T01008                                 

Gene name
SPHK2
Definition
sphingosine kinase 2
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
bta  Bos taurus (cow)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bta00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:bta04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:bta04020]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:bta04666]
Human Diseases; Infectious diseases; Tuberculosis [PATH:bta05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
18
AA seq 612 aa AA seqDB search
MNGNLEAEERQDQRPEQELTWSWGYRPRSALDRVKAMAPPPPLAPSTPLLHGEFGSYPDR
GPRFALTLTPQALHIQRLRPKPEARPRGGLVLLTEVSGCCTLRSRSPLDSAAYFCVYTYP
RGRRGARRRAARTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRPP
RLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLNLSEWDGI
VTVSGDGLLYEVLNGLLQRPDWEEAVKTPVGILPCGSGNALAGAVNRHGGFEPALGIDLL
LNCSLLLCRGGSHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTLG
TVLGLATLHTYRGRFSYLPATVEPASPAPAHGLPRAKSELTLAPAPAPPVAHSPLHRSVS
DLPLPLPQPALTSPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLPSPPGTPKAA
QLSPISEGASEMAASSGLPPPTPGAPVSISAGGPPDHLLPPLGTPIPPGWVTMEGDFVLI
LAILPSHLGADLVAAPHARFDDGXVHLCWVRSGISRAALLRMFLGHGAWYPLQPGCPYLG
YAAAHAFQSQVG
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaaccttgaagcagaggagcggcaggaccagaggccagagcaggagctgacc
tggagctggggctaccggcctagaagcgccctggacagggtcaaggccatggccccccca
ccgccactggcccccagcaccccactcctgcatggcgagtttggctcctacccagaccgc
ggcccacgcttcgccctcactctcacaccacaagccctgcacatacagcggttgcgccca
aagcccgaggcccggccccggggtggcctggtcctgctgaccgaggtctcaggctgctgc
accctgcggagccgaagccccctggactcagcagcctacttctgcgtctacacctacccc
aggggccggcgcggggcccggcgcagagctgcacgcaccttccgggccgacggggcagcc
acctacgaggagaaccgcgctgaggcccagcgctgggccactgccctcacgtgtctgctc
cgtggactgccactgcctggggacggggaaatcaccccggacctcctgcctaggccgccc
cgattgctcctattggtcaatccctttggggggcggggcctggcctggcagtggtgtaag
aaccatgtgctgcccatgatctccgaagcggggctgtccttcaacctgatccagacagaa
cgacagaaccatgcccgtgagctggtccaggggctgaacctgagcgaatgggacggcatc
gtcacagtctcgggagatgggctgctgtatgaggtgctgaatggactcctacaacgcccc
gactgggaagaggctgtgaagacccccgtgggcattctcccctgtggctcgggcaatgcg
ttagcaggagccgtgaaccggcatgggggatttgagcctgccctgggcattgacctgcta
ctcaactgctccttactgctctgccggggtggcagccacccgctggacctgctctccgtg
actctggcctccggctcccgctgtttctctttcctgtctgtggcctggggcttcgtgtca
gatgtggacatccagagcgagcgcttcagggccctgggcagtgctcgcttcacgctgggc
acagtcctgggccttgccacgctgcacacctaccgcggccgcttctcctacctccctgcc
actgtggaacccgcctcgcctgcccctgcccatggcctgccaagggccaagtcagagttg
accctggccccggccccagccccacccgtggcccactcacccctgcatcgctcagtgtca
gacctgcccctgcccctgcctcagcctgccctgacctcccctggctcacctgaacccctg
cccatcctgtctctcaacggtgggggcccagagctggctggggactggggtggggctggg
gatgccccactctccccggacccactgctgccctcgcccccggggacccccaaggcagct
cagctctcacccatcagcgagggggcctcagaaatggcagcatcctctgggctcccacct
cccacccctggtgccccagtatccatctctgctgggggaccacctgatcacctgctccct
cctctaggcactccgatacccccaggctgggtgacgatggagggagactttgtgcttatt
ttggccatcttacccagccacctgggggctgacctcgtggcggccccccacgcgcgcttt
gacgacggcnctgtgcacctgtgctgggttcgcagcggcatctcgcgggcggcgctactg
cgcatgtttctgggccatggagcgtggtacccacttcagcctggctgtccgtacctgggc
tacgccgcagctcatgccttccaaagccaggtcggctga

DBGET integrated database retrieval system