KEGG   Bos taurus (cow): 533330Help
Entry
533330            CDS       T01008                                 

Gene name
PRKG2
Definition
protein kinase, cGMP-dependent, type II (EC:2.7.11.1)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
bta  Bos taurus (cow)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    533330 (PRKG2)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    533330 (PRKG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    533330 (PRKG2)
  Digestive system
   04970 Salivary secretion
    533330 (PRKG2)
  Nervous system
   04730 Long-term depression
    533330 (PRKG2)
  Sensory system
   04740 Olfactory transduction
    533330 (PRKG2)
  Environmental adaptation
   04713 Circadian entrainment
    533330 (PRKG2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     533330 (PRKG2)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   533330 (PRKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
6
AA seq 762 aa AA seqDB search
MGNGSVKPKHSKNPDGHPGNLTASALRSRVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHLQGGSLPRASPDKVPLEVQRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVSQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISEDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSSWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKKILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARNLPSPLQRELSGPTDHSYFDKYPPERGVPPDELSGWDKDF
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggttcggtgaaacccaaacactccaagaatccagatgggcaccccgggaac
ctcaccgccagcgccctccggagcagggtgacagagctggaaagagagctgagaaggaag
gatgctgagatccaggagcgggaataccacctgaaggagctgcgggagcagctgtccaaa
cagactgtggccatcgcggagctcacggaggagctccagaacaagtgcatccagctgaac
aagcttcaggatgtggtgcacctgcagggaggaagcctgccccgggcgtccccggacaaa
gtgcctcttgaggttcagcggaagacctcgggattggtctccctccacagcaggagggga
gcgaaggctggagtgtccgccgagccgaccacccgaacctatgacctcaacaaaccccct
gaattttcctttgagaaagcaagagtcagaaaggactccagtgagaagaagctcattaca
gatgcccttaataaaaatcaatttctgaagagactggatcctcagcagatcaaagacatg
gtggaatgcatgtatgggagaaactaccagcaagggagctacattattaagcaaggagaa
ccaggaaaccatatctttgtactggcagagggtcgactagaggtgtcccaaggggagaaa
ttgctgtcatccatccctatgtggaccacgtttggggagctagccattttatacaactgt
acaagaactgcctctgtgaaagctattaccaatgttaaaacatgggcactagatcgagag
gtattccagaatataatgagaaggacagctcaagctagagatgaacagtacagaaacttc
ctcagaagtgtatccttgctgaagaatttacctgaagataaactaaccaagatcattgac
tgcttggaagtggaatactatgacaaaggagattacattattagagagggcgaggaagga
agtacgtttttcattttagcaaaaggaaaggtaaaagtcactcaaagtactgaaggccat
gatcaaccacagctaataaaaacactgcagaaaggagaatattttggagaaaaagctctt
atcagtgaagatgtcagatcagctaacattatcgccgaggaaaatgatgtcgcatgcctg
gttatagatcgagaaacattcaaccaaacagtggggacttttgaagaactccagaaatat
cttgaagggtatgtggcaaacctgaaccgggatgatgaaaaaagacatgcgaagagatcc
atgtctagctggaagctgtccaaagcactctctttggagatgattcaactgaaggagaaa
gtggccagattttcctcatcatcccccttccagaaccttgagattatcgcaacactgggc
gttggtgggttcggaagagttgagcttgttaaggtgaaaaatgagaacgttgcttttgct
atgaagtgtataaggaagaagcacatcgttgacacgaagcagcaggagcatgtctactca
gaaaagaagatcctggaagagctatgctcacccttcattgtgaaattatatcgcaccttc
aaggacaataagtatgtatacatgcttctggaggcctgcttaggtggggagctgtggagt
atattaagagacagaggcagctttgatgaacccacctccaagttctgtgttgcctgtgtg
acagaagcattcgattacctgcatcgactaggtattatctacagagacctgaaaccagaa
aacttaattctagatgctgagggctatcttaaattggttgactttggatttgctaagaaa
ataggatctggacagaaaacatggacgttctgtggaactccagagtatgtagctcctgaa
gtcattctcaacaaaggacatgacttcagtgtggatttttggtccctgggaattctagta
tatgagctcctcacgggcaaccctcctttttctgggattgaccaaatgatgacctacaat
ctgattctcaaaggcattgaaaaaatggattttcccagaaagataacaagacgacctgag
gatctgattcggaggctttgcaggcaaaatccaacagaaagactgggaaatctgaagaat
ggaatcaatgacattaagaaacacaggtggttaaatggttttaattgggagggactgaaa
gcacgaaatcttccatcacctttacaaagagagctcagtggacccacagatcacagctac
tttgacaagtatcctcctgaaaggggggtgcctccagatgagctgtcaggctgggacaaa
gacttctga

DBGET integrated database retrieval system