KEGG   Bos taurus (cow): 533428Help
Entry
533428            CDS       T01008                                 

Gene name
GALC
Definition
galactosylceramidase (EC:3.2.1.46)
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
bta  Bos taurus (cow)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bta00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bta04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
10
AA seq 685 aa AA seqDB search
MAERLIQASWQRRAKAMTAAAGLAGQAAVPLLLCALLAPSGAYVLDDSEGLGREFDGIGA
VSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFNWPYVNLQLTAYYIVTWIV
GSKHYHDLDIDYIGIWNERAFDINYIKVLRRMLNHQGLQHVKIIASDNLWEPISASMLLD
PELLKVIDVIGAHYPGTLTVKDARLTKKKLWSSEDFSTVNGDMGAGCWGRILNQNYVNGY
MTSTIAWNLVASYYQQLPYGRCGLMTAQEPWSGHYVVEAPIWVSAHTTQFTQPGWYYLKT
VGHLERGGSYVALTDGLGNLTVIVETMSYKHSKCIRPLLPYFNVSHQFATFDLKGSFSQI
QELQVWYTKLGKPSERFLFKQLDSLWLLDSGGSFTLELQEDELFTLTTLTSGRKGSFPPP
PKSQRFPSVYEDNFNIDYPFFSEAPNFADQTGVFEYYVNMEDPGDHRFTLRQVLNQRPIT
WAADAFNTISVIGDYSWSNLTIKCDVYIETPEKGGVFIAGRVNKGGILIRSARGIFFWIF
ANGTYRVTGDLAGWIIYSLGHADVTAKKWYTLTLTLNGRFSSGKLNGKTLWKNISVNFPE
NGWAAIGTHSFEFAQFDNFRVEASH
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgcctaattcaggcctcctggcaacgccgggcgaaagccatgacggccgcc
gcgggtttggcgggccaagccgcggtgcccctgctgctgtgcgcgctgctggcacccagc
ggcgcgtacgtgctcgacgactccgaggggctgggccgggagttcgacggcatcggagcc
gtcagcggcggcggggcaacctcccgacttctagtaaattacccagagccctaccgttct
gaaatactggattatctctttaagccaaacttcggtgcctcactgcatatcctaaaagtt
gaaataggtggtgatgggcagacaacagatggcacggagccctcccacatgcactacgca
ctggatgagaattatttccgagggtatgaatggtggttgatgaaggaggctaagaagcgg
aaccctaatattacactcatagggctgccgtggtcgttccctggatggctggggaagggc
ttcaattggccttacgtcaaccttcagctgaccgcgtactacatcgtgacctggattgtg
gggtccaagcattatcatgacctggacattgattatatcggaatatggaatgagagggca
tttgacattaattatatcaaggtgttaagaagaatgctgaaccatcaaggtctccagcac
gtgaaaatcatagcgagtgataatctctgggagcccatttctgcttctatgctgcttgac
cctgagctcttgaaggtgattgatgtaataggagctcattaccctgggacacttacagta
aaggatgctaggttgactaagaagaagctttggtcttctgaagattttagcactgtaaat
ggtgatatgggtgcaggctgctggggtcgcatattgaatcagaattacgtcaatggctac
atgacttccaccattgcttggaacttggtggccagttactatcagcagttgccatatggg
cgttgtggactgatgactgctcaggagccatggagtgggcactacgtggtggaagctcct
atctgggtatcagctcataccactcagtttactcaaccaggttggtattacctgaagaca
gttggccatttagagagaggaggaagctacgtagctctgacggatggcttaggtaacctc
actgtcatcgttgaaactatgagttataaacattccaagtgtatacgaccacttcttccc
tatttcaatgtgtcacatcagtttgctacgtttgatcttaagggttcttttagtcaaata
caagagctacaggtgtggtataccaaacttggaaaaccatcggagagatttctcttcaaa
caactggattctctatggctgctcgatagcggtggcagcttcaccctggagctgcaggag
gacgagctgttcaccctcaccacgctcacctccggccgcaaaggcagcttcccgccacct
cccaagtcccagcgcttcccctctgtctatgaggataacttcaacattgattacccgttc
tttagtgaagctccgaattttgctgaccagactggggtgtttgaatactacgtgaatatg
gaagaccccggagaccatcgcttcacactgcggcaggttctcaatcagaggcccatcacg
tgggctgccgacgcgttcaacaccatcagcgttatcggggattactcatggtccaatctg
actataaaatgtgatgtgtacatagagacccctgagaagggaggcgtgttcattgctgga
agagtcaataaaggtggtattttgattagaagtgccagggggattttcttctggattttt
gcaaatggaacctacagagtcacaggcgatctagctggatggatcatatatagtttagga
catgctgatgttacagcaaaaaaatggtatacactcactttaactctgaatggtcgtttc
tcctccggcaagctgaatggcaagaccctctggaagaacatctctgtgaacttcccagaa
aacggctgggccgcgattgggactcattcctttgaatttgcacagtttgacaacttccgt
gtggaagcctcacactaa

DBGET integrated database retrieval system