KEGG   Bos taurus (cow): 533481Help
Entry
533481            CDS       T01008                                 

Gene name
TAT
Definition
(RefSeq) tyrosine aminotransferase
  KO
K00815  
tyrosine aminotransferase [EC:2.6.1.5]
Organism
bta  Bos taurus (cow)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Cysteine and methionine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of amino acids
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    533481 (TAT)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    533481 (TAT)
   00350 Tyrosine metabolism
    533481 (TAT)
   00360 Phenylalanine metabolism
    533481 (TAT)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    533481 (TAT)
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    533481 (TAT)
Enzymes [BR:bta01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.5  tyrosine transaminase
     533481 (TAT)
Amino acid related enzymes [BR:bta01007]
 Aminotransferase (transaminase)
  Class I
   533481 (TAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
18
AA seq 447 aa AA seqDB search
MQDHGSLPSVLDVHVNVAGRSSVLGKVKSRKARWSVRPSDMSNKTFNPIRAIVDNMKVKP
NPNKTMIALSIGDPTVFGNLPTDPEVTQAMKDALDSGKFNGYVPSIGYLSSREEVASYYH
CPEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILVPRPGFSLYRTLAESMGIEVKLYN
LLPEKNWEIDLKQLESLIDEKTVCLIVNNPSNPCGSVFSRRHLQKILAVAARQCVPILAD
EIYGDMVFSDSKFEPLATLSSKVPILSCGGLAKRWLVPGWRMGWILIHDRRDIFGNEIRD
GLTKLSQRILGPCTLVQGALKSILCRTPRVFYHNTLSFLKSNADLCYGALAAIPGLRPIH
PSGAMYLMVGIEMEHFPEFENDVEFTEQLVAEQSVHCLPATCFEYPNFFRVVITVPEVMM
LEACSRIQEFCEQHYHCAEGSQEECDK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatcacggcagcctcccctcagttctggatgtgcatgtcaacgttgctgggaga
agctctgtgctgggaaaagtgaaaagcaggaaggccagatggtccgtgaggccctcggac
atgtccaacaaaactttcaatcccatccgggccattgtggacaacatgaaggtgaagcca
aatccaaacaagaccatgattgctttgtcgattggggaccctactgtatttggaaacctg
ccgacagatcctgaagttacccaagcaatgaaagatgccctcgactcagggaagtttaat
ggctatgtcccctccattggctacttatccagtcgggaggaagttgcttcttattaccac
tgtcccgaggcacccctggaagctaaggatgtcattctgacaagtggctgcagtcaggct
attgaactgtgtttggctgtgttggccaacccagggcaaaacatcctagttccgagacct
ggcttctctctctacaggactctggctgaatctatgggaattgaggtcaaactctacaat
ttattgccagagaagaattgggaaattgacctgaaacaattagaatctctgattgatgaa
aagacagtttgtcttattgtcaacaatccatcaaacccttgtgggtcagtgttcagtaga
cgtcatctccagaaaattttggcagtggctgcaaggcaatgtgttcccattttagctgat
gagatctatggagacatggtgttttcagattccaaatttgagcctctggccaccctcagc
agcaaagtccccatcctgtcctgtggagggctggccaagcgctggctggttcctggctgg
aggatgggctggatccttatccatgaccgaagagatatttttggcaatgagatccgagat
gggctgacgaagctaagtcaacggatcctgggcccctgcacccttgtccagggagctctg
aaaagcatcctgtgtcgcacccctcgtgtgttctaccacaacactctaagcttcctcaag
tccaatgcggatctctgctatggggcattggctgccatccccggactccggcccattcac
ccttctggggccatgtacctcatggttggaattgagatggaacatttcccagaatttgag
aatgatgtggagttcacggagcagttagttgctgagcaatctgtccactgcctcccagca
acgtgctttgagtatccaaatttcttccgagtggtaatcacagtccctgaagtgatgatg
ctggaggcctgtagccggatccaggagttctgtgaacagcactaccattgtgctgaaggg
agccaggaggaatgtgacaaatag

DBGET integrated database retrieval system