KEGG   Bos taurus (cow): 533587Help
Entry
533587            CDS       T01008                                 

Gene name
UGT2B10, UGT2B4, UGT2B7
Definition
(RefSeq) UDP glucuronosyltransferase 2 family, polypeptide B10
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bta  Bos taurus (cow)
Pathway
bta00040  Pentose and glucuronate interconversions
bta00053  Ascorbate and aldarate metabolism
bta00140  Steroid hormone biosynthesis
bta00830  Retinol metabolism
bta00860  Porphyrin and chlorophyll metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta00982  Drug metabolism - cytochrome P450
bta00983  Drug metabolism - other enzymes
bta01100  Metabolic pathways
bta05204  Chemical carcinogenesis
Module
bta_M00014  Glucuronate pathway (uronate pathway)
bta_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    533587 (UGT2B10)
   00053 Ascorbate and aldarate metabolism
    533587 (UGT2B10)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    533587 (UGT2B10)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    533587 (UGT2B10)
   00860 Porphyrin and chlorophyll metabolism
    533587 (UGT2B10)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    533587 (UGT2B10)
   00982 Drug metabolism - cytochrome P450
    533587 (UGT2B10)
   00983 Drug metabolism - other enzymes
    533587 (UGT2B10)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    533587 (UGT2B10)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     533587 (UGT2B10)
Glycosyltransferases [BR:bta01003]
 Others
  Hydrophobic molecule
   533587 (UGT2B10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4 SEN1_N
Motif
Other DBs
NCBI-GeneID: 533587
NCBI-ProteinID: NP_001039819
BGD-bta: BT16080
Ensembl: ENSBTAG00000039991
UniProt: Q2KIH0
Position
6
AA seq 529 aa AA seqDB search
MSMQRLSLLLLLQLTCYFNSGSCGKVLVWPMEYSHWMNMKTILDELVTRGHEVTVLIPSV
TTFIDPKKPSSLKLETFPPSLTKEESENFVKLFVEAWMHAVRDSFWNHLSMVQSLFWGYS
DILMKMCKEVVSNKKLMTKLHEERFDVIFADAVGPCGELLAEILKIPFMYSLYSTPGSSV
EKKSGRLPFPPSYVPAMFSELSDHMTFMERVKNMIYVLYFDFWFQAYNEKNWNQFYSEVL
GRPTTLVETMGKAEMWLIRNYWDFSFPRPRLPNFEFVGGLHCKPAKSLPKEMEEFVQSSG
ENGIVVFSLGSMVSNMSKERANVIASALAQIPQKVLWRYDGKKPDTLGPNTQLYKWIPQN
DLLGHPKTKAFVTHGGSNGIYEAIYHGIPIVGLPLFADQPHNIVHMKAKGAAVRLDLETM
STEDLLNALKEVINNPSYKENMMRLSAIHHDRPVKPLDLAVFWIEFVMHHKGAKHLRPAV
HNLTWLQYHSLDVIGFLLACVATGAFVITKCCLFCYQKFAGKGKKGKRD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgcaacggctctcacttctgctgctgctacaactgacttgctactttaattct
ggaagttgtggaaaggtgctggtgtggccaatggaatatagtcattggatgaatatgaag
acaattctggatgaacttgtgacaaggggtcatgaggtgactgttttgataccttcagtt
accactttcattgatcccaaaaaaccatcttctctcaaattggagactttccctccatct
ttaactaaagaagaaagtgagaattttgtcaaactttttgttgaggcatggatgcatgcg
gtgagagactccttttggaatcatctttcaatggtgcaaagtttattttggggatattct
gatattttaatgaagatgtgtaaagaagttgtttcaaataagaaacttatgacaaaactg
catgaagaaaggttcgatgtcatttttgcagatgctgttggaccctgtggtgagctgctg
gctgagatacttaaaataccattcatgtatagtctctactccacacctggatcttcagtt
gaaaagaagagtggaaggcttccattcccaccatcctatgtacctgctatgttttcagaa
ttaagtgatcacatgacattcatggagagggtcaaaaatatgatatatgtactgtatttt
gacttctggttccaggcatacaatgagaagaactggaatcagttttacagtgaagtacta
ggaaggcccactacattagttgagacaatggggaaagctgaaatgtggctcattcgaaac
tattgggatttttcatttcctcgcccacggctaccaaattttgaatttgttggagggctc
cactgcaaacctgccaaatccctgcctaaggaaatggaagagtttgtgcagagctctgga
gaaaatggcattgtggtgttttcattggggtcaatggtcagtaacatgtcaaaagaaaga
gccaatgtgattgcatcagctcttgcccagattccacaaaaggttctatggagatatgat
ggcaagaaaccagacaccctaggacccaatactcagctgtataagtggatcccccaaaat
gaccttcttggtcatccaaaaaccaaagcgtttgtaactcatggtggaagcaacggcatt
tatgaggccatctaccacgggatccctatagtgggccttcctttgtttgctgatcaacct
cataacattgttcacatgaaggccaagggagctgctgtcagactggacttggaaacaatg
tcaacagaagatttgctcaatgcattgaaggaagttattaataatccttcctacaaagag
aatatgatgaggttatcagccattcatcatgatcggcctgtaaagcccctagacctagca
gtcttctggattgagttcgtcatgcaccacaaaggagccaagcacctgcgaccagctgtc
cacaacctcacctggctccagtaccactctctggacgtgattgggtttctgctagcctgc
gtagcaactggtgcatttgtcatcacaaagtgttgcctgttttgttaccagaagtttgct
ggcaaaggaaagaaggggaaaagagactag

DBGET integrated database retrieval system