KEGG   Bos taurus (cow): 534057Help
Entry
534057            CDS       T01008                                 

Gene name
CIR1
Definition
corepressor interacting with RBPJ, 1
Orthology
K06066  
CBF1 interacting corepressor
Organism
bta  Bos taurus (cow)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    534057 (CIR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 485 aa AA seqDB search
MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMG
DERVKNGLNFMYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFG
IQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFA
LKRNVLGRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKKK
DRKKKKLQKSRSKHKKHKNKPSSPSSSSTTSSSSPSPLSSSSSSSDSSESSSESDGKGTK
IQKRRRKKNKRSGHNNSDSEERGKSKKRKRDEEHSCSHSNKEKPKFLKQESSRENSKRSH
SDSDRKPRSHDQSPGKRGSGRKRSSRSQSRDERSRRSRSRSHGSYKPREIRKRPRRSPSE
DRDRRNDTRCHGADTYRGGQVHREHSGDKHTGVTPKEWSRGREQRDFHVTINCKEKHLHF
FLKYL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggggaaatccttcgccaatttcatgtgcaagaaggactttcatcctgcttccaaatcc
aacatcaaaaaagtttggatggcagaacagaaaatatcatatgataagaagaaacaagaa
gagttaatgcaacagtatctaaaagaacaagaatcatatgataatagattgctcatggga
gatgaacgtgtaaagaatggccttaatttcatgtatgaggctccaccaggggctaaaaaa
gaaaacaaagagaaagaagaaacagaaggagagaccgaatacaaatttgaatggcagaaa
ggggccccacgagaaaaatatgccaaagatgacatgaacatcagagatcagccctttggt
attcaggttcgaaatgtaagatgcattaaatgtcacaaatggggtcatgtcaacacagat
cgagaatgtcctttgtttggtctttctggaattaatgcaagttcagttcccactgatggc
tcagggccatcgatgcacccctcggagctaatagcggagatgagaaacagtgggtttgcg
ctgaaacgaaatgtactggggagaaacttgaccgcaaatgatccatcacaggaatatgtt
gcaagcgagggtgaagaagatccagaagttgaatttttaaagtcactaacaaccaaacaa
aaacagaaactcctcaggaaattagatcgactcgagaagaaaaaaaagaaaaagaaaaaa
gatagaaaaaagaaaaagcttcagaagagcagaagtaaacacaaaaaacataaaaacaag
ccctcctccccctcctcctcctccaccacctcctcctcctccccatccccactgtcctcc
tcctcctcctctagtgacagttcagaaagcagcagcgagagcgacggcaaagggacaaaa
atacagaagaggagaagaaagaaaaacaagcgttcagggcataacaacagtgattctgaa
gagagaggcaagtctaagaagagaaaacgggatgaggaacactcttgcagtcacagtaac
aaggaaaagcctaagtttttaaaacaagagagttctagggagaatagcaaacggagccat
tctgattctgacagaaagcccagaagccatgaccagagtccagggaagagaggatctgga
agaaagaggagcagcaggagccagagcagggatgagaggagcaggagaagccggagcaga
agtcacggtagttacaagccaagagaaataaggaaacggccacggcgcagtccaagtgaa
gatcgggacagaagaaatgacaccagatgccatggcgcagatacgtacagaggagggcaa
gtgcacagagagcattcgggagataagcatactggagtgacaccaaaagaatggagcaga
ggtagagaacagagggacttccatgtgacaataaactgcaaagaaaaacatctccacttt
tttctcaaatacctttag

DBGET integrated database retrieval system