KEGG   Bos taurus (cow): 534262Help
Entry
534262            CDS       T01008                                 

Gene name
USP38
Definition
ubiquitin specific peptidase 38 (EC:3.4.19.12)
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     534262 (USP38)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   534262 (USP38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
17
AA seq 1040 aa AA seqDB search
MDKILEGLVSSSHPLPLKRVIVRKVVESAEHWLDEAQCEAMFDLTTRLILEGQDPFQRQV
GHQVLEAYARYHRPEFESFFNKTFVLGLLQQGYHSLDRKDVAIVDYIHNGLKLIMSCPSV
LDLFSLLQVEVLRMVCERPEPQLCARLSDLLTDFVQCIPKGKLSITFCQQLVRTIGHFQC
VSTQEKELREYVSQVTKVSNLLQNIWKAEPSTLLPSLQEVFASISSTDASFEPSVALASL
VQHIPLQMITVLIRSLTTDPNVKDASMTQALCRMIDWLSWPLAQHVDTWVIALLKGLAAV
QKFTILIDVTLLKIELVFNRLWFPLVRPGALTVLSHMLLSFQHSPEAFHLIVPHVVNLVH
SFKSDGLPSSTAFLVQLTELIHCMMYHYSGFPDLYEPILEAIKDFPKPSEEKIKLILNQS
AWTSQSNSLASCLSRLSGKSETGKTGLINLGNTCYMNSVIQALFMATDFRRQVLSLNLNG
CNSLMKKLQHLFAFLAHTQREAYAPRIFFEASRPPWFTPRSQQDCSEYLRFLLDRLHEEE
KILKVQSSHKSSESPGCSETSLQEVANKAAVLTETHCTSDGEKTLIEKMFGGKLRTHICC
LNCRSTSQKVEAFTDLSLAFCPSSSMENLSFQDPASSPSTQDDGLTQASGPGPSKEPGVC
NASAVAIACDSAVNERMVDSPDEFCCTEDTSVPNDSSKMLVNKDVPQKPGGETTPSVTDL
LNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYDQKYHVRRKIL
DNVSLPLVLELPVKRTPFSSLSESWSLDVDFTDISENLAKKLKPSGTEEACSPKLVPYLL
SSVVVHSGVSSESGHYYSYARNVTGTESSCQMCPQPETLAFSSSRNHLLGRESPTVVIEQ
DLENKDMSKEWFLFNDSRVTFTSFQSVQKITSRFPKDTAYVLLYKRQNSTNGLNGNNSTT
GLWVNGDPPLQKELMDAITKDNKLYLQEQELNARARALQAASASCSFRPNGFDDNDPPGS
CGPTGGGGGGGFNTVGRLVF
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcctggagggcctggtgagttcttcgcacccgctgcccctgaagcgggtg
atcgtgcggaaggtggtggagtcggcagagcactggctggacgaggcgcagtgcgaggcc
atgtttgacctgacgacccggctcatcctggagggccaggacccctttcagcggcaggtg
ggccaccaagtgctggaggcctacgcgcgctaccaccggccggagttcgagtccttcttc
aacaagacgttcgtgctgggtctccttcagcagggctaccactcgctggacaggaaggac
gtagccatcgtggactacattcacaacggcctgaagctgatcatgagctgcccgtcggtg
ctggacctcttcagcctgctgcaggtggaggtgctgcggatggtatgcgagaggccagag
ccgcagctgtgcgcccgactcagcgacctcctgacagacttcgtgcagtgcatccccaag
gggaagttgtccatcaccttctgccaacagctagttcgaacgataggccacttccagtgc
gtgtccacccaggagaaagagctgcgggaatatgtttcgcaggtgacaaaagtgagtaac
ttgctgcagaacatctggaaggccgagccctccaccctgctgccttctctgcaagaagtt
tttgcaagcatttcctccacagatgcttcatttgaaccttctgtagcactggcgagcctc
gtgcagcacatccctcttcagatgatcacagttctcatcaggagccttacaacggatcca
aatgtaaaagatgcgagtatgacccaagctctttgcagaatgattgactggctgtcttgg
ccattggctcagcacgtagacacatgggtgattgcactcttgaaaggactggcagctgtc
cagaagtttactattttgatagatgttactttactgaaaatagaattggtttttaatcgc
ctttggtttcctctcgtgcgacctggtgctctcacagttctctctcacatgctgcttagt
tttcagcattctccagaggcgttccatttgattgttcctcatgtggttaatctggttcat
tccttcaaaagtgatggtctgccttccagtacagccttcctagtgcagttaacagaactg
attcactgtatgatgtatcactactctggatttccagatctctacgaacccatcctggag
gcaataaaggatttccctaagcccagtgaagagaagattaaattgattctcaatcaaagt
gcctggacttctcaatccaattctttggcatcttgcttgtctagactttctggaaaatct
gaaactgggaaaactggtcttattaatctagggaatacatgttatatgaacagtgttata
caagcattgtttatggccacagatttcaggagacaagtattatctttaaatctaaatggg
tgcaattcattaatgaaaaaattgcagcatctttttgcctttttggctcatacacagaga
gaagcatatgcacctcggatattctttgaggcttccagacctccatggtttacccccaga
tcacaacaagactgttctgaatacctcaggtttctactagacaggctccatgaagaagaa
aagatcttgaaagttcagtcctcacacaagtcttctgaaagtccaggatgcagtgaaact
tctttacaggaggtagccaataaagcagctgtcctaacagagacccattgcacaagtgac
ggtgagaagacgctaattgaaaaaatgtttggaggaaaactgcgaactcatatttgttgt
ctgaactgcaggagtacctcacagaaagtggaagcctttacagatctttcactggccttt
tgtccttcctcttccatggaaaacttgtcttttcaagatccagcatcatcacccagtaca
caagatgatggcctaacacaggccagcgggcctggtccttcaaaagaaccaggagtctgt
aacgcgtcagcagttgccattgcctgcgactcagctgtgaatgaaagaatggttgacagt
cctgatgagttctgctgtactgaggacacttctgtccctaatgactctagcaagatgctt
gttaataaagatgtacctcagaaaccaggaggtgaaaccacaccttcagtgactgactta
ttaaattattttttggctccagagattcttactggtgacaaccagtattattgtgaaaac
tgtgcctctctgcagaatgccgagaaaactatgcaaatcacagaggaacctgaatacctt
atccttactctcttaagattttcatatgatcagaagtatcatgtgagaagaaaaatacta
gacaatgtgtcactgccactggttttggagttgccagttaaaagaactcctttctcttca
ttgtcagaaagttggtctctagatgttgacttcactgacattagtgagaatctagctaaa
aagttaaagccttctgggactgaagaagcttgctccccaaaattggtgccctatctcttg
agttctgtggtcgttcactctggtgtgtcctcagaaagtgggcattactattcttatgcc
agaaacgtcacaggaacagagtcctcctgccagatgtgcccccagcctgaaactctggcg
ttttcctcctcccggaatcacttactagggagagagagtcccactgtagtgattgaacag
gacttggaaaataaggacatgtcaaaagaatggtttttatttaatgacagccgagtgacg
tttacttcatttcagtcagtccagaaaattacgagtaggtttcccaaggatacagcttat
gtacttttgtataagagacagaacagtactaatggtttaaatggtaataattcaaccact
ggactctgggtaaatggagacccacctctacagaaagaactaatggatgctataacaaaa
gacaataaactatatttacaggaacaagagttgaatgctcgagcccgggccctacaagct
gcatctgcatcctgttcttttcggcccaatggatttgatgacaacgatccacccggaagc
tgtggaccaactggtggtgggggtggaggcggatttaatacagttggaagactcgtattt
tga

DBGET integrated database retrieval system