KEGG   Bos taurus (cow): 534781Help
Entry
534781            CDS       T01008                                 

Gene name
PBK
Definition
PDZ binding kinase (EC:2.7.11.1)
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     534781 (PBK)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   534781 (PBK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
8
AA seq 324 aa AA seqDB search
MEETNNFKTPSRLSEKRKSALCLTPCINIPASPFMQKLGFGTGVNVYLMQRSPRGLSHSP
WAVKKINPRCNDDYQSMYQKRLTDEAKILKTLNHPNIIGYRAFTKASDGSLCLAMEYGGE
KSLNDLIEERNKDSRDPFPAAIILKVALNMARGLKYLHQDKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEALEEDGIITDKADIFAFGLTLWEM
MTLSIPHINLPDDDDDDEDKTFDESDFDDDAYYAALGTRPPVNMEELDETYQKVIELFSV
CTNEDPKDRPSAACIVEALEVDIL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaccaataatttcaagacaccaagcagattatctgaaaaaaggaaatctgca
ttatgtttaactccatgtataaatattcctgcctctccatttatgcagaagcttggcttt
ggtactggggtaaatgtctaccttatgcaaagatctccaagaggtttgtctcattctcct
tgggctgtgaaaaagattaatcctagatgtaatgatgattatcagagtatgtatcaaaag
agactaactgatgaagctaagattttgaaaacactcaatcatccaaacattataggttac
cgtgctttcactaaagctagcgatggcagtctgtgtcttgctatggagtatggaggtgaa
aagtctctgaatgacttaatagaagaacgaaataaagatagccgagatccttttccagca
gccataattttaaaagttgctttgaacatggcaagagggttaaagtatctgcaccaagat
aagaaactgctccatggagatataaagtcttcaaatgttgttattaaaggcgattttgaa
acaattaaaatctgtgatgtaggagtctctcttccattggatgaaaatatgactgtgact
gaccctgaggcctgttacattggcactgagccttggaaacctaaagaagctctggaggag
gatggtattattactgacaaggcagacatatttgcctttggtcttactctgtgggaaatg
atgactttatctattccacacattaatcttccagatgatgatgatgatgatgaagataaa
acttttgatgaaagtgattttgatgatgacgcatactacgcagctttgggaactaggcca
cctgttaatatggaggaactggatgaaacataccagaaagtaattgagctcttctccgta
tgcactaatgaagatcctaaagaccgtccttctgctgcgtgcattgttgaggctttagaa
gtggatatcctgtga

DBGET integrated database retrieval system