KEGG   Bos taurus (cow): 534808Help
Entry
534808            CDS       T01008                                 

Gene name
ADH7
Definition
(RefSeq) alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00010  Glycolysis / Gluconeogenesis
bta00071  Fatty acid degradation
bta00350  Tyrosine metabolism
bta00830  Retinol metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta00982  Drug metabolism - cytochrome P450
bta01100  Metabolic pathways
bta05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    534808 (ADH7)
  Lipid metabolism
   00071 Fatty acid degradation
    534808 (ADH7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    534808 (ADH7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    534808 (ADH7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    534808 (ADH7)
   00982 Drug metabolism - cytochrome P450
    534808 (ADH7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    534808 (ADH7)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     534808 (ADH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-GeneID: 534808
NCBI-ProteinID: XP_010804269
Position
6
AA seq 375 aa AA seqDB search
MGTAGKVIKCKVALLWEQKKLFSTEIQVVPSKAKEVCIKMLAMGICQTDDHVIKGSIVSK
FSVIVGHEATGVVDSIGEGVTTVKPDDKVIPHFLPQCRECNACRNPDGNPCIRTDITGHG
VLADGSTRFTCKGKPVYHFLSTSTFIEYTAVDETSIAKSDDAAPPEKVCLTGCGFSTGYR
ATIKIGKVTPSSMCVVFGLGGVGLSVIMGCNSAGASRIVGADLNKDKFEKAMAVGATECI
SPKDFTKPISEVLSEMTGDTTGCSFEVIGHLETMVRAMSICSMNXVVSVVAGAPPSAKML
TXHPVLLFTGHMWKGCIFEGWKSRNYVPNLVTDFLEKKFDLDKLITHDLPFRKINERFEL
LNSGQSKIDIDLQKE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgggcactgctgggaaggttattaaatgtaaagtggctctgctatgggaacagaagaaa
ctcttttccactgagatacaagttgttccatcaaaggcaaaagaagtctgtattaagatg
ttggcaatgggaatctgtcaaacagatgaccatgtgataaaagggagcatagtgtctaag
ttttcagtgattgtgggacatgaagccactggggttgtagacagcattggagaaggagtc
actacagtgaaaccagatgacaaagtcatcccccactttctgcctcagtgtagagaatgc
aatgcttgtcgcaacccagatggcaacccttgtataaggacagacatcactggtcatgga
gtcctggctgatggcagcaccagatttacatgcaagggcaagccagtctatcacttcttg
agcaccagtacattcattgagtacacggcggtggatgaaacttccattgctaagagtgat
gatgcagctcctcctgagaaagtctgtttaactggatgtggattttccactggatacagg
gccactattaagattggcaaggtcacccctagctcaatgtgtgtggtctttggcctggga
ggagttggcctttcggtcatcatgggctgtaattcagctggtgcatccaggatcgttggg
gctgacctcaacaaagacaaatttgaaaaggccatggctgtaggagccactgagtgcatc
agccccaaggacttcaccaagcccatcagtgaggtgctgtcagaaatgacaggtgacact
acaggctgcagttttgaagttattgggcatcttgaaactatggtaagagccatgagcatc
tgcagcatgaactaagtggtcagtgtggtggcaggggctcctccatcagccaagatgctc
acgntccacccagtgctgctcttcactggacacatgtggaaagggtgcatttttgaaggt
tggaaaagcagaaattatgttccaaacctagtgactgatttcctggaaaagaaatttgac
ctggacaaattgataacacatgatttaccttttagaaaaatcaatgaaagatttgaactg
cttaactcaggacaaagcaagattgatatagacttacaaaaagaataa

DBGET integrated database retrieval system