KEGG   Bos taurus (cow): 534808Help
Entry
534808            CDS       T01008                                 

Gene name
ADH7
Definition
alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
bta  Bos taurus (cow)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    534808 (ADH7)
  Lipid metabolism
   00071 Fatty acid degradation
    534808 (ADH7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    534808 (ADH7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    534808 (ADH7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    534808 (ADH7)
   00982 Drug metabolism - cytochrome P450
    534808 (ADH7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    534808 (ADH7)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     534808 (ADH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 365 aa AA seqDB search
MGTAGKVIKCKVALLWEQKKPFSTEIQVVPPKAKEVRIKMLAMGICQTDDHVIKGSIVSK
FSVIVGHEATGVVDSIGEGVTTVKPDDKVIPHFLPQCRECNACRNPDGNPCIRTDITGHG
VLADGSTRFTCKGKPVYHFLSTSTFIEYTAVDETSIAKSDDAAPPEKVCLTGCGFSTGYR
ATIKIGKVTPSSMCVVFGLGGVGLSVIMGCNSAGASRIVGADLNKDKFEKAMAVGATECI
SPKDFTKPISEVLSEMTGDTTGCSFEVIGHLETMVRALCICSMNXVVSVVAGAPPSAKML
TXHPVLLFTGHMWKGCIFEGWKSRNYVPNLVTDFLEKKFDLDKLITHDLPFRKINERFEL
LNSGQ
NT seq 1097 nt NT seq  +upstreamnt  +downstreamnt
atgggcactgctgggaaggttattaaatgtaaagtggctctgctatgggaacagaagaaa
cccttttccactgagatacaagttgttccgccaaaggcaaaagaagtccgtattaagatg
ttggcaatgggaatctgtcaaacagatgaccatgtgataaaagggagcatagtgtctaag
ttttcagtgattgtgggacatgaagccactggggttgtagacagcattggagaaggagtc
actacagtgaaaccagatgacaaagtcatcccccactttctgcctcagtgtagagaatgc
aatgcttgtcgcaacccagatggcaacccttgtataaggacagacatcactggtcatgga
gtcctggctgatggcagcaccagatttacatgcaagggcaagccagtctatcacttcttg
agcaccagtacattcattgagtacacggcggtggatgaaacttccattgctaagagtgat
gatgcagctcctcctgagaaagtctgtttaactggatgtggattttccactggatacagg
gccactattaagattggcaaggtcacccctagctcaatgtgtgtggtctttggcctggga
ggagttggcctttcggtcatcatgggctgtaattcagctggtgcatccaggatcgttggg
gctgacctcaacaaagacaaatttgaaaaggccatggctgtaggagccactgagtgcatc
agccccaaggacttcaccaagcccatcagtgaggtgctgtcagaaatgacaggtgacact
acaggctgcagttttgaagttattgggcatcttgaaactatggtaagagccctttgcatc
tgcagcatgaactaagtggtcagtgtggtggcaggggctcctccatcagccaagatgctc
acgntccacccagtgctgctcttcactggacacatgtggaaagggtgcatttttgaaggt
tggaaaagcagaaattatgttccaaacctagtgactgatttcctggaaaagaaatttgac
ctggacaaattgataacacatgatttaccttttagaaaaatcaatgaaagatttgaactg
cttaactcaggacaaag

DBGET integrated database retrieval system