KEGG   Bos taurus (cow): 534913Help
Entry
534913            CDS       T01008                                 

Definition
mariner-like transposase (EC:2.1.1.43)
Orthology
K11433  
histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bta00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
1
AA seq 343 aa AA seqDB search
MPKRKTMEMMLEKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTAKERTVQWWFKKFRK
GDESLEDDERSARPSEVDNDQLREIIDADPLKTTRKIAEELKVNHSTVVRHLKQIGKVKK
LNKWVPHELTEIQKNRRFEVSSSLILRNKNEPFLDRIVTCHEKWILSDNQRQPAQRLDRG
KTLNLYQKKIMVTVWWSAAGLIHYSFLNPGETITSEKYAQQINEMHQKLQHLQPALVNRK
GPVLLHDNARPHVAQPALQKFNELGYEVLPHPPHSPDLLPTHYHFFKHLDNFLQGKRFHN
QQDAENAFQEFVESRSTGFYATGINELTSRWQKCVDCNGSYFD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaggaagactatggaaatgatgttagagaaaaagcaaattcgagcgattttc
ttattcgagttcaaaatgggtcgtaaagcagcagagacaactcgcaacatcaacaacgca
tttggcccaggaactgctaaggaacgtacagtgcagtggtggtttaagaagtttcgcaaa
ggagatgagagccttgaagatgacgagcgtagtgcacggccatcagaagttgacaacgac
caattaagagaaatcattgatgccgatcctcttaaaactacacgaaaaattgccgaagaa
ctcaaggtcaaccattctacagtcgttcggcatttgaagcaaattggaaaggtaaaaaag
ctcaataagtgggtgcctcatgagctgaccgaaattcaaaaaaatcgtcgttttgaagtg
tcatcttctcttattctacgcaacaaaaatgaaccatttctcgatcggattgtgacatgc
cacgaaaagtggattttatctgataaccagcgacaaccagctcagaggttggatcgaggg
aaaactctgaacttgtaccaaaaaaagatcatggtcactgtttggtggtctgctgccggt
cttatccactatagctttctgaatcctggtgaaaccattacatctgagaagtatgctcaa
caaatcaatgagatgcaccaaaaactacaacacctacagccagcattggtcaacagaaag
ggcccagttcttctccacgacaatgcccgaccacatgtcgcacaaccagcccttcagaag
tttaatgaattgggctacgaagttttgcctcatccgccacattcacctgacctattacca
acccactaccacttcttcaagcatctcgacaactttctgcagggtaaacgcttccacaac
cagcaggatgcagaaaatgctttccaagagtttgtcgaatcccgaagcacgggtttttac
gctacaggaataaacgaacttacttctcgttggcaaaaatgtgttgattgtaatggttcc
tattttgactaa

DBGET integrated database retrieval system