KEGG   Bos taurus (cow): 535327Help
Entry
535327            CDS       T01008                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
bta  Bos taurus (cow)
Pathway
bta01522  Endocrine resistance
bta04010  MAPK signaling pathway
bta04015  Rap1 signaling pathway
bta04068  FoxO signaling pathway
bta04071  Sphingolipid signaling pathway
bta04218  Cellular senescence
bta04261  Adrenergic signaling in cardiomyocytes
bta04370  VEGF signaling pathway
bta04380  Osteoclast differentiation
bta04550  Signaling pathways regulating pluripotency of stem cells
bta04611  Platelet activation
bta04620  Toll-like receptor signaling pathway
bta04621  NOD-like receptor signaling pathway
bta04622  RIG-I-like receptor signaling pathway
bta04625  C-type lectin receptor signaling pathway
bta04657  IL-17 signaling pathway
bta04658  Th1 and Th2 cell differentiation
bta04659  Th17 cell differentiation
bta04660  T cell receptor signaling pathway
bta04664  Fc epsilon RI signaling pathway
bta04668  TNF signaling pathway
bta04670  Leukocyte transendothelial migration
bta04714  Thermogenesis
bta04722  Neurotrophin signaling pathway
bta04723  Retrograde endocannabinoid signaling
bta04728  Dopaminergic synapse
bta04750  Inflammatory mediator regulation of TRP channels
bta04912  GnRH signaling pathway
bta04914  Progesterone-mediated oocyte maturation
bta04917  Prolactin signaling pathway
bta04926  Relaxin signaling pathway
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta05014  Amyotrophic lateral sclerosis (ALS)
bta05132  Salmonella infection
bta05133  Pertussis
bta05140  Leishmaniasis
bta05142  Chagas disease (American trypanosomiasis)
bta05145  Toxoplasmosis
bta05152  Tuberculosis
bta05160  Hepatitis C
bta05164  Influenza A
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05169  Epstein-Barr virus infection
bta05205  Proteoglycans in cancer
bta05418  Fluid shear stress and atherosclerosis
Module
bta_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    535327 (MAPK13)
   04010 MAPK signaling pathway
    535327 (MAPK13)
   04370 VEGF signaling pathway
    535327 (MAPK13)
   04668 TNF signaling pathway
    535327 (MAPK13)
   04068 FoxO signaling pathway
    535327 (MAPK13)
   04071 Sphingolipid signaling pathway
    535327 (MAPK13)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    535327 (MAPK13)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    535327 (MAPK13)
 Organismal Systems
  Immune system
   04611 Platelet activation
    535327 (MAPK13)
   04620 Toll-like receptor signaling pathway
    535327 (MAPK13)
   04621 NOD-like receptor signaling pathway
    535327 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    535327 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    535327 (MAPK13)
   04660 T cell receptor signaling pathway
    535327 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    535327 (MAPK13)
   04659 Th17 cell differentiation
    535327 (MAPK13)
   04657 IL-17 signaling pathway
    535327 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    535327 (MAPK13)
   04670 Leukocyte transendothelial migration
    535327 (MAPK13)
  Endocrine system
   04912 GnRH signaling pathway
    535327 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    535327 (MAPK13)
   04917 Prolactin signaling pathway
    535327 (MAPK13)
   04926 Relaxin signaling pathway
    535327 (MAPK13)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    535327 (MAPK13)
  Nervous system
   04728 Dopaminergic synapse
    535327 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    535327 (MAPK13)
   04722 Neurotrophin signaling pathway
    535327 (MAPK13)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    535327 (MAPK13)
  Development
   04380 Osteoclast differentiation
    535327 (MAPK13)
  Environmental adaptation
   04714 Thermogenesis
    535327 (MAPK13)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    535327 (MAPK13)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    535327 (MAPK13)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    535327 (MAPK13)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    535327 (MAPK13)
  Infectious diseases
   05132 Salmonella infection
    535327 (MAPK13)
   05133 Pertussis
    535327 (MAPK13)
   05152 Tuberculosis
    535327 (MAPK13)
   05164 Influenza A
    535327 (MAPK13)
   05160 Hepatitis C
    535327 (MAPK13)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    535327 (MAPK13)
   05169 Epstein-Barr virus infection
    535327 (MAPK13)
   05145 Toxoplasmosis
    535327 (MAPK13)
   05140 Leishmaniasis
    535327 (MAPK13)
   05142 Chagas disease (American trypanosomiasis)
    535327 (MAPK13)
  Drug resistance
   01522 Endocrine resistance
    535327 (MAPK13)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     535327 (MAPK13)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   535327 (MAPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 Kinase-like Haspin_kinase Kdo DUF4023
Motif
Other DBs
NCBI-GeneID: 535327
NCBI-ProteinID: NP_001014947
BGD-bta: BT21674
Ensembl: ENSBTAG00000010007
UniProt: Q5E9Q6
Position
23
AA seq 366 aa AA seqDB search
MSFTRKKGFYKQDVNKTAWELPKTYVSLTHIGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHTDVEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLNDKAAKSYIQSLPQSPKKDFSQLFPRASPQATDLLEKMLELDVDKRLTAS
QALAHPFFEPFRDPEEETEAQQPLEDSLEREKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcacccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccctgacgcacataggcagcggggcctacggctcagtgtgc
tcagccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc
cagtccgagatctttgccaagcgggcttatcgggagctgctgctgctgaaacacatgcag
catgaaaacgtcatcgggcttctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacggacctgcagaagatcatggggatg
gagttcagtgaggacaagatccagtaccttgtgtaccagatgctcaagggtcttaagtac
atccactcagctggggtcgtccacagggacctgaagccgggcaacctcgctgtgaatgag
gactgtgagctgaagatcttggattttgggttggcacggcatacggatgtggagatgacg
ggttacgtggtgacccgctggtaccgggcccctgaggtgattctcagctggatgcattac
aatcagactgtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaag
acgctgttcaaggggaaagactacctggaccagctgacccagattctgaaagtgaccggg
gtgccgggtgcagagtttgtgcagaagctcaatgacaaggcggccaaatcctacatccag
tccctgccacaaagccccaaaaaggatttctctcagctcttcccgcgtgccagcccccag
gccacagacctgctggagaagatgctggagctggacgtggacaagcgcctgacggcctcg
caggccctcgcccaccccttctttgagcccttccgggaccctgaggaggagacagaggcc
cagcagccgctcgaggattccttagaacgcgagaaactcacagtggacgaatggaagcag
cacatctacaaggagatcgtgaacttcagccccattgcccggaaggactctcggcgccgg
agtggcatgaagctgcagtga

DBGET integrated database retrieval system