KEGG   Bos taurus (cow): 535376Help
Entry
535376            CDS       T01008                                 

Gene name
TGFBR2
Definition
transforming growth factor, beta receptor II (70/80kDa) (EC:2.7.11.30)
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    535376 (TGFBR2)
   04350 TGF-beta signaling pathway
    535376 (TGFBR2)
   04390 Hippo signaling pathway
    535376 (TGFBR2)
   04068 FoxO signaling pathway
    535376 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    535376 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    535376 (TGFBR2)
  Cellular commiunity
   04520 Adherens junction
    535376 (TGFBR2)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    535376 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    535376 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    535376 (TGFBR2)
   05210 Colorectal cancer
    535376 (TGFBR2)
   05212 Pancreatic cancer
    535376 (TGFBR2)
   05220 Chronic myeloid leukemia
    535376 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    535376 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    535376 (TGFBR2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     535376 (TGFBR2)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   535376 (TGFBR2)
Enzyme-linked receptors [BR:bta01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   535376 (TGFBR2)
Cytokine receptors [BR:bta04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   535376 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
22
AA seq 567 aa AA seqDB search
MGRGLLGGLWPLHVVLWTRIASTIPPHVPKSVNSDMMVTDHNGAIKLSQLCKFCDVRSST
CDNQKSCWSNCSITAICEKPEEVCVAVWRKNDENITLETVCHDPKIAYHGFVLDDAASSK
CIMKERKGSGETFFMCSCSSEECNDHIIFSEEYTSSNPDLLLVIFQVTGVSLLPPLGIAI
AVIITFYCYRIHRQQKLSPAWDSGKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRRLGGSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKGDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQTVCETLAECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSSSEEKIPEDGSLNTTK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggccgggggctgctcgggggcctgtggccgctgcacgtcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggttaacagcgatatgatggtcactgac
cacaacggcgccatcaagctgtcgcagctgtgtaagttctgcgacgtgcggtcgtccacc
tgtgacaaccagaagtcctgctggagcaactgcagcatcacggccatctgcgagaagccg
gaggaggtctgcgtggctgtctggaggaagaatgatgagaacatcacgctggagacagtc
tgccatgaccccaagattgcctaccatggatttgtcctggacgatgctgcttcttcaaag
tgtatcatgaaggaaagaaaggggtccggagagactttcttcatgtgctcctgcagctcc
gaagaatgcaatgaccacattatcttctccgaagagtacaccagcagtaaccccgacttg
ctgctggttatcttccaagtgacaggcgtcagcctcctgccaccgctgggcatcgccatc
gcagtcatcatcactttctactgctaccgcatccaccggcagcagaagctgagcccagcc
tgggactcgggcaagccgcgcaagctgatggagttcagtgagcacctggccatcatcctg
gaggacgaccgctccgacatcagctccacctgcgccaacaacatcaaccacaacacggag
ctgctgcccatcgagctggacaccctggtgggcaaggggcgcttcgccgaggtctacaag
gccaagctgaagcagaacacgtctgagcagttcgagaccgtggccgtcaagatcttcccc
tacgaggagtatgcctcctggaagacggagaaggacatcttctcggacatcaacctcaag
cacgagaacatcctgcagttcctgacggccgaggagcgcaagacggagctgggcaagcag
tactggctcatcactgccttccacgccaagggcaacctgcaggagtacctgacgcgccac
gtcatcagctgggaggacctgcgccggctgggcggctcgctggcccgcggcatcgcgcac
ctgcacagcgaccacaccctgtgcggccggcccaagatgcccatcgtgcacagggacctc
aagagctccaacatcctggtcaagggcgacctcacctgctgcctctgcgacttcgggctc
tcactgcggctggaccccaccctgtcagtggatgacctggccaacagtgggcaggtggga
acggcgagatacatggctccagaggtcctcgagtccaggatgaatctggagaacgtggag
tccttcaagcagacggatgtctactccatggccctggtgctctgggagatgacgtctcgc
tgcaacgcagtgggagaagtgaaggactatgagcctccgttcgggtctaaggtgcgggag
catccctgtgtggaaagcatgaaggacaacgtgctgagagatcgaggccgaccagagatt
cccagctcctggctcaaccaccagggcatccagacggtgtgcgagacgctggccgaatgc
tgggaccatgaccccgaggcccggctcacggcgcagtgcgtggccgagcgcttcagcgag
ctggagcacctggacaggctctccgggaggagcagctcggaggagaagatccccgaagat
ggctccctcaacactaccaaatag

DBGET integrated database retrieval system