KEGG   Bos taurus (cow): 535403Help
Entry
535403            CDS       T01008                                 

Gene name
KAT6B, MYST4
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     535403 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
28
AA seq 2054 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTTNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGGLD
GKGAPKYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQPCTSHVLA
PGTTQKLKPPLSSLPPPTPISGQSPSSQKSSTSVSSTSPQSSSSQSSVPSFSSLTNNSQL
KALFDGLSHIYTTQGQSRQKGHPSYAPPKRMRRKTEFPLTAKSKAHFFGKRDVRSRFISH
SSSSSWGMARGRIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKISIKQESTDINVIGNKDTVTEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRR
EKLILGHMEKLKTCSRTNELDPESLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEILSSRANSRQSPAKVQSKNKYLHSPESRPVAGERGQLMELSKESSEEEEEEEEEEE
EEEEEEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKRRRINSSVT
TETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGRKPVLRKAFQHQPGKKRQTEE
EEGKDNHCFKNTDPCRNNMDDGANNLKEASRDNPEPLKCKQWPKGTKRGLSKWRPNKERK
TGFKLNLYTPPETPMEPDDQVTVEEQKETPADKSSPSSTRIEEGVKEAVEPLLPQDENGR
EETCAPVSPNKSPAGKPEDDVIKPEEEEEEEEEEEEEGNVEKDPSGAKSQEKEEPEVCMD
KEDPVRLDDHEEEEEEEEEPSHNEGHDADDEDDSHMESAEVEKEEHPREAFKEVLENQEA
FLDLSVQPSHSNPEVLMDCGVDLPASCNSEPKELAGATETAPESDEEPPGEQAQKQDQKN
SEEVDSEFKEGNTATLEIDSETVQAVQSLTQENSEQDDTFQDCAETQEACRSLQNYTHAD
QSPQISATLDDCQQSDHSSPVSSVHSHPGQSVRSVSSPSVPALENSYAQISPDQSAISVP
SLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNGS
SQNSCSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQQSSISSPPTCSVKSPQGCVVERP
PSSSQQLAQCSMAANFTPPMQLAEIPETGNANLGLYERMGQSDFGAGHYPQPSATFSLAK
LQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSVPGGPQAQATMT
PPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHVSMRTKSASLSPAAATH
QSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPSPAYNVNSVNMNMNTLNAMNGYSMSQ
PMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTPPHSNMMYTAPGHHGYMNT
GMSKQSLNGSYMRR
NT seq 6165 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaata
aaaaagcaaaagcaaaggccctctgaagagagaatctgccatgccgttagcacttcccat
gggttggataagaagacagtctctgaacagctggaactcagcgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcctacaaggacccagacaaccctgggcgcttt
tcatcagttaaaccaggcacttttcctaagtcaaccaaggggtctagaggatcatgcaat
gatctgcgcaacgtggattggaataaacttctaaggagagcaattgaaggactggaggag
ccaaatggctcctccctgaagaacattgagaagtatctcagaagtcaaagtgatctcaca
agcaccaccaccaacccagcctttcagcagcggctgcgactgggggccaaacgcgcagtg
aacaatgggaggttactgaaagacggaccgcagtacagggtcaattacggaggcttagat
ggcaaaggggctcccaagtaccccagtgctttcccatcttcgctcccacctgtcagcctt
ctaccccacgagaaagatcagccccgtgccgatcccattccaatatgtagcttctgtctg
gggacaaaggaatcaaatcgtgaaaagaaaccagaagaacttctctcttgtgcagattgt
ggcagtagtgggcacccatcctgtttgaaattttgtcctgaattaacaacaaatgtaaag
gccttaaggtggcagtgcatcgaatgcaagacgtgcagtgcatgcagaatccaaggcaaa
aatgcagataatatgcttttctgtgactcctgtgatagaggattccatatggagtgctgt
gatcccccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatccggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagccatgcacttctcatgtgttggct
ccaggtaccacacaaaagctaaaacctccactttcttcactcccacccccgacccccatc
tctggtcagagccccagctcacaaaagtccagcacttctgtttcttctacctctcctcag
agttcctccagccagtccagcgtgccctcctttagcagtcttactaataacagccagctg
aaggcactctttgacggactctctcatatctataccactcagggacagtctcgccaaaag
ggacacccaagttatgcaccgcctaaacgtatgcgtcgtaaaaccgaattccctctcaca
gcaaagtctaaagcccatttctttggaaaaagagatgttagaagtaggtttatttctcac
tcctcctcctctagctgggggatggctagagggcgtatttttaaagcaattgctcacttc
aagcgaacaactttccttaaaaagcacaggatgctaggcaggttaaaatataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatacggaaatcaaaataagcatcaaacaggaaagtacagatataaat
gtgattggaaacaaggataccgttactgaagaggatttggatgttttcaagcaggcccag
gaactgtcttgggagaagatagagtgtgaaagtggagtagaagactgtggccggtaccct
tctgtaatagaatttgggaaatatgaaatccaaacctggtactcctcgccttacccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagt
aaaaatattttattaagacactcaaagaaatgtggatggtttcatcctccagcaaatgaa
atttaccgaaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttat
tgccaaaacctttgcctgttagccaagctcttcctggaccacaaaacattgtattatgat
gtcgagccattccttttttatgtccttacaaaaaatgatgaaaagggctgtcatctggtt
ggatacttctctaaggaaaaactttgccagcagaagtataatgtctcctgcataatgatc
atgccccagcaccaaaggcaaggatttggacggtttctcattgatttcagctatttgctt
tctcgaagagaaggccaagcagggtctcctgaaaagccactctccgatctaggccgtctc
tcctacctggcctactggaagagtgtcatcttagaatatctctaccaccaccacgagcgg
cacatcagcatcaaagccatcagcagagctacgggcatgtgcccccatgacatcgccacc
actctgcagcacctccacatgattgacaagagagatggccgatttgtcatcattagacgg
gaaaagttgatattgggccacatggaaaagttgaaaacctgttcccggaccaatgaactt
gatccagagagtctgaggtggaccccaatcttaatttctaatgctgcagtttctgaagaa
gaacgagaagccgaaaaagaggccgagcggctaatggaacaagctagctgctgggaaaaa
gaggagcaagaaatcctgtcatctagagctaacagtaggcaatcacctgcaaaagtacaa
tcgaaaaataaatatttgcattccccggagagccggccagtggcaggggagcgagggcag
ctgatggagctgtctaaagagagcagtgaagaagaggaggaggaagaagaggaagaggaa
gaggaggaggaggaagaagaggaggaggaggaagaggaagaagaggaagaggaagaaaat
atccaaagctctcctccaagattgactaaaccacagtcagttgccataaagagaaagagg
ccttttgtactaaagaagaaaaggggtcgtaaacgcaggaggatcaacagcagtgtaaca
actgagaccatttctgagacgacagaagtactgaatgagccctttgacaactcagatgaa
gagaggccaatgccacagctggagcctacctgtgagattgaagtggaggaggatggcagg
aagccagtgctgagaaaagcattccaacatcagcctgggaagaaaagacagacagaggaa
gaggaaggaaaagacaatcattgctttaagaatactgacccttgtagaaacaatatggat
gatggtgcaaataacttgaaagaagccagtagagacaatcccgaacctctgaagtgcaaa
cagtggccaaaaggaacaaagcgtggtctgtctaagtggaggccaaacaaagagaggaag
actggatttaaactgaacttgtacaccccgccagaaacacccatggagcctgatgaccag
gtaacagtggaagaacagaaggagactccagcagacaaatccagcccctcttccaccagg
attgaggagggggtcaaggaagccgtggaacccctgctgcctcaggacgaaaacggaagg
gaggagacgtgtgcacctgtaagtccaaataaatcaccggctggaaaacctgaagacgat
gtaatcaaacctgaggaggaagaggaggaggaagaagaagaggaagaggaaggaaatgta
gaaaaagaccccagtggtgccaagagtcaggaaaaagaggagccagaagtctgcatggac
aaagaagaccctgtgcgtttggatgatcatgaagaggaggaggaagaggaggaagagcca
tctcacaacgaggggcatgatgccgatgatgaggatgacagtcacatggagtctgctgaa
gtggagaaggaagaacacccaagagaagccttcaaagaagtactggaaaaccaggaggct
tttttagaccttagtgtccagcctagtcattcaaacccagaggtcctaatggactgtggt
gttgacctcccagcttcgtgtaatagtgaacctaaggagcttgctggagccactgaaact
gcccctgaatctgatgaggaacccccaggagagcaggcacagaagcaggaccaaaagaac
agtgaagaagtagattctgagttcaaagagggaaacacagccaccttggaaatagactct
gagaccgtccaggcggttcagtccttgacccaggagaacagtgaacaggacgacaccttt
caggattgcgccgagactcaagaggcctgtagaagcctacagaactacacccatgcagac
caaagcccacagatctccgccactctagatgactgccagcagtcagaccacagcagccca
gtttcatccgtccattcccaccctggccagtcagtacgttctgtcagtagcccaagcgtc
cctgccctggaaaacagctatgcccaaatcagcccagatcaaagtgccatctcagtgccg
tctctgcagaacatggagaccagtccaatgatggacgtcccgtccgtttcggatcattcg
cagcaagttgtggacagcgggtttagtgacctgggcagtatcgagagcacaaccgagaac
tacgaaaacccgagcagctatgattctaccatgggcggcagcatttgtggaaatggctct
tcacagaacagctgctcctacagcaacctcacctccagcagtctgacacagagcagctgt
gctgtcacccagcagatgtccaacatcagcgggagctgcagcatgctgcagcagagcagc
atcagctcccccccgacctgcagcgtcaagtctcctcaaggctgtgtggtggagaggccc
ccaagcagcagccagcagctggcacagtgcagcatggctgctaacttcacgccacccatg
cagctggctgagatccccgagactggcaatgccaaccttggcttatatgaacggatgggt
cagagtgattttggggctgggcattacccacagccgtcagccaccttcagccttgccaaa
ctacagcagttaactaatacacttattgatcattcattgccttacagccattccgctgct
gtaacttcctatgcaaacagtgcctctttgtccacaccattaagtaacacagggcttgtt
cagctttctcagtctccacactccgtccctgggggaccccaagcacaagctaccatgacc
ccaccccccaacctgactcctcctccaatgaatctgccaccacctctgttgcaacggaac
atggctgcatcaaatattggcatctcccacagccaaagactgcaaacccagattgccagc
aagggccacgtctccatgagaaccaaatcagcgtctctgtcaccagccgctgccacccat
cagtcgcaaatctatgggcgctcccagactgtagccatgcaaggtcctgcacggacttta
acgatgcagaggggcatgaacatgagtgtgaacctgatgccatccccagcctacaatgtc
aactctgtgaacatgaacatgaacaccctcaatgccatgaacgggtacagcatgtcccag
ccgatgatgaatagtggctaccacagcaatcatggctacatgaatcagacgccccagtac
cctatgcagatgcagatgggcatgatggggacccagccatatgcccagcagccaatgcag
accccgccccacagtaacatgatgtacacggcccccggacaccatggctacatgaacaca
ggcatgtccaaacagtctctcaatgggtcctacatgagacggtag

DBGET integrated database retrieval system