KEGG   Bos taurus (cow): 535416Help
Entry
535416            CDS       T01008                                 

Gene name
SIRT6
Definition
sirtuin 6 (EC:2.4.2.31)
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
bta  Bos taurus (cow)
Pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    535416 (SIRT6)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     535416 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
7
AA seq 359 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEVFDPPEELEQKVWELAQLIWQSSSVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPTFDTTFENAQPTKTHMALVQLERVGLLHFLVSQNVDGLHV
RSGFPRDKLAELHGNMFIEECVKCKMQYVRDTVVGSMGLKPTGRLCTVAKSRGLRACRGE
LRDTILDWEDSLPDRDLTLADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPHMVERALPPLPRPPAPKLEPK
EEASPQLNSPVPANPKQEPTAEPCTQHNGSGPTSPKRERPDSPSPHRPPKRVKTEVVPS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcggggctttcgccgtatgcagacaagggcaagtgcggtcta
cccgaggtcttcgacccccccgaggagttggagcagaaggtgtgggagctggcacagctc
atctggcagtcctccagtgtggtgttccacacaggcgcaggcatcagcactgcctcaggc
atccccgacttcaggggcccccatggcgtctggacgatggaggagcggggcctggccccc
acgttcgacaccaccttcgagaacgcccagcccacaaagacccacatggcgctggtccag
ctggagcgtgtgggcctcctgcacttcctggtcagccagaacgtggacggactgcacgtg
cgctccggcttccccagagacaagctggcagagctccacggaaacatgtttatagaagaa
tgtgtcaagtgtaagatgcagtatgtccgggacaccgtggtgggcagcatgggcctgaaa
cccacgggccggctctgcaccgtggccaagtccagggggctgcgggcctgcaggggggag
ctgagagataccatcctggattgggaggattccctgcctgaccgggacctcaccttggcc
gacgaagccagcaggaatgcagacctgtccatcacactgggcacctccctgcaaatccgg
cccagcgggaaccttcccctcgccaccaagcgacgtggaggtcgcctggtcatcgtcaac
cttcagcccaccaagcacgaccgccacgcagacctgcgaatccacggttatgttgatgag
gtcatgacgcggctcatgaaacacctgggcctggagatcccggcctgggacggcccccac
atggtggagagggcactgccgcccctgccacgcccacctgcccccaagctggagcccaag
gaggaggcctccccccagctcaacagcccagtgcctgccaaccccaagcaggaacccaca
gctgagccctgcacccagcacaatggttctggacccaccagccccaaaagggagcggccg
gacagcccttcccctcacaggcctcccaaaagagtgaaaaccgaggtggtgcctagctga

DBGET integrated database retrieval system