KEGG   Bos taurus (cow): 535416Help
Entry
535416            CDS       T01008                                 

Gene name
SIRT6
Definition
(RefSeq) sirtuin 6
  KO
K11416  mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
bta  Bos taurus (cow)
Pathway
bta04714  Thermogenesis
bta05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    535416 (SIRT6)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    535416 (SIRT6)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     535416 (SIRT6)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     535416 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2 TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 535416
NCBI-ProteinID: NP_001091553
BGD-bta: BT19067
Ensembl: ENSBTAG00000019909
UniProt: A5D7K6
Position
7
AA seq 359 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEVFDPPEELEQKVWELAQLIWQSSSVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPTFDTTFENAQPTKTHMALVQLERVGLLHFLVSQNVDGLHV
RSGFPRDKLAELHGNMFIEECVKCKMQYVRDTVVGSMGLKPTGRLCTVAKSRGLRACRGE
LRDTILDWEDSLPDRDLTLADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPHMVERALPPLPRPPAPKLEPK
EEASPQLNSPVPANPKQEPTAEPCTQHNGSGPTSPKRERPDSPSPHRPPKRVKTEVVPS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcggggctttcgccgtatgcagacaagggcaagtgcggtcta
cccgaggtcttcgacccccccgaggagttggagcagaaggtgtgggagctggcacagctc
atctggcagtcctccagtgtggtgttccacacaggcgcaggcatcagcactgcctcaggc
atccccgacttcaggggcccccatggcgtctggacgatggaggagcggggcctggccccc
acgttcgacaccaccttcgagaacgcccagcccacaaagacccacatggcgctggtccag
ctggagcgtgtgggcctcctgcacttcctggtcagccagaacgtggacggactgcacgtg
cgctccggcttccccagagacaagctggcagagctccacggaaacatgtttatagaagaa
tgtgtcaagtgtaagatgcagtatgtccgggacaccgtggtgggcagcatgggcctgaaa
cccacgggccggctctgcaccgtggccaagtccagggggctgcgggcctgcaggggggag
ctgagagataccatcctggattgggaggattccctgcctgaccgggacctcaccttggcc
gacgaagccagcaggaatgcagacctgtccatcacactgggcacctccctgcaaatccgg
cccagcgggaaccttcccctcgccaccaagcgacgtggaggtcgcctggtcatcgtcaac
cttcagcccaccaagcacgaccgccacgcagacctgcgaatccacggttatgttgatgag
gtcatgacgcggctcatgaaacacctgggcctggagatcccggcctgggacggcccccac
atggtggagagggcactgccgcccctgccacgcccacctgcccccaagctggagcccaag
gaggaggcctccccccagctcaacagcccagtgcctgccaaccccaagcaggaacccaca
gctgagccctgcacccagcacaatggttctggacccaccagccccaaaagggagcggccg
gacagcccttcccctcacaggcctcccaaaagagtgaaaaccgaggtggtgcctagctga

DBGET integrated database retrieval system