KEGG   Bos taurus (cow): 535834Help
Entry
535834            CDS       T01008                                 

Gene name
SRD5A3
Definition
steroid 5 alpha-reductase 3 (EC:1.3.99.5)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    535834 (SRD5A3)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     535834 (SRD5A3)
    1.3.1.94  polyprenol reductase
     535834 (SRD5A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
6
AA seq 318 aa AA seqDB search
MATWAGTEVSALNPLRAFWLTLAATFLLTLLLQLVPPGLLPGCAFFQDLIRYGKTKEGAP
PRPAACRAFDVPKRYFSHFYIISVLWNGFLLWSLTHSLFMGAPFPHWLHGLLRILGTAQF
RGGELALSAFLVLVFLWLHSLRRLFECVYVSVFSNAVIHAVQYCFGLVYYVLVGLTVLSQ
VPLDGRNVYVIGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILSNLRKNKAGVVIHCNH
RIPFGDWFEYVSSPNYLAELLIYISMAVTFGFYNLTWWLVVTYVFFNQALSAFLSHKFYK
SKFISYPKHRKAFLPFLF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggctacgtgggcggggaccgaggtctcggcgctgaacccgctgcgcgccttttggctc
acgcttgctgccaccttcctactgaccctgctgctgcagctcgtgccgcccggcctgctt
ccgggctgcgcgttcttccaggacctgatccgctatggaaaaaccaaggaaggggcgcca
ccgcgcccggccgcctgccgggcctttgatgttcccaagaggtatttttcgcatttctac
atcatctcagtgctgtggaacgggttcctgctttggagccttacccactctctgttcatg
ggagcaccttttccacactggcttcacggtctgctcagaattcttgggactgcgcagttc
cgagggggtgagctcgcactgtctgcattcttggtgctagtgtttctgtggctgcacagc
ctgcgaagactgtttgagtgcgtctacgtcagtgtcttctccaatgccgtgatccacgcc
gtgcagtactgttttggacttgtgtactatgtccttgttggcctaactgtgctgagccaa
gtgcccctggacggcaggaacgtctatgtgatagggaagaatctcttgatgcaggctcgg
tggttccatatcctcggaatgatgatgttcatctggtcatctgcccatcagtataaatgt
catgtcattctcagcaatctcaggaaaaacaaagcaggagtggtcattcactgtaaccac
cgaatcccttttggagactggtttgaatacgtctcttcccctaactacttggcagagctg
ctgatctacatttccatggctgtcaccttcggtttctacaacttgacttggtggctcgtg
gtaacatatgtcttcttcaaccaggccctgtctgctttcctcagccacaaattctacaaa
agcaaattcatctcctacccgaagcacaggaaagctttcctgccatttctgttttaa

DBGET integrated database retrieval system