KEGG   Bos taurus (cow): 535883Help
Entry
535883            CDS       T01008                                 

Gene name
HIBCH
Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
bta  Bos taurus (cow)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    535883 (HIBCH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    535883 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    535883 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    535883 (HIBCH)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     535883 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
2
AA seq 386 aa AA seqDB search
MGLQGLCRLMSRFNSYKRTNIILQHLKMSNHTDAAAEVLLERKGCAGVITLNRPRFLNTL
TLGMIRQIYAQLKKWEQDPKTFLIIIKGAGEKAFCAGGDIRALSEARNTNQKMLQDLFRE
EYILNNAIDSCQKPYIALIHGITMGGGVGVSVHGQFRVATEKSVFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYTAGIATHFVDFEKLGMLEEDLLALKSPSKENI
ADVLETYHAKSKTDQDKPFILEEHMDKINSWFSANTVEQIVDNLQQDGSSFALEQLKVIK
KMSPTSLKITLRQLMEGSSKTLPEVLIMEYRLSQACMKGHDFHEGVRAVLIDKDQSPKWK
PADLKEVTDEDLNDYFKSLGSNDLKF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggggttgcaggggttgtgcagactcatgtcgaggtttaattcatataaaaggactaat
atcatactgcagcatttgaaaatgtctaatcacacagatgcagcagcggaagtcctgttg
gaaagaaaaggttgtgcaggagtgataacactaaacagaccaaggtttctgaataccctg
actcttggtatgattcggcagatttacgcacagctaaagaagtgggaacaagatccgaaa
actttcctgatcatcataaagggagctggtgaaaaggctttctgtgctggaggtgatatc
agagcactctcagaagctagaaatacaaaccagaaaatgcttcaagatttattccgagag
gaatatattctgaacaatgccattgattcttgccagaaaccatatattgcacttattcat
ggaattacaatgggtgggggagttggtgtctcagttcatgggcaattccgagtggctacc
gaaaagtctgtttttgcgatgccagaaacagcaatagggctattccctgatgtgggtgga
ggttatttcttgccacgacttcaaggaaaacttgggtacttccttgcattaacaggattc
aggctgaaaggaagagatgtgtacacagcaggaattgctacacacttcgtagattttgaa
aagttgggcatgctagaagaagatttgttagccctgaaatctccttcaaaagaaaatatt
gcagatgtcttagaaacttaccatgcaaagtcaaagactgatcaagacaagccttttata
ctcgaggaacacatggacaaaataaacagttggttctcagctaatactgtggaacagatt
gttgacaatttacagcaagacggctcgtcttttgccctggagcagctgaaggtaattaaa
aaaatgtctccaacttcactaaagatcacactaaggcaactcatggaggggtcttcaaag
accttgccagaagtattaattatggaatatcggctgagtcaagcttgtatgaaaggccat
gactttcatgaaggcgttagggcagttttaatagataaagaccagagtccaaagtggaaa
ccagctgacctaaaagaagttactgatgaagatttgaatgattacttcaaatctctggga
agtaatgatttgaaattttga

DBGET integrated database retrieval system