KEGG   Bos taurus (cow): 536337Help
Entry
536337            CDS       T01008                                 

Gene name
PTPRR, PCPTP1
Definition
protein tyrosine phosphatase, receptor type, R (EC:3.1.3.48)
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    536337 (PTPRR)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     536337 (PTPRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
5
AA seq 410 aa AA seqDB search
MILYRLKEKFQLSLRQDKEKNQEIHLSPIVLQPAHSEDKTANSMVHPEQAPKVLSVVVDP
QGRYTPEIKATTSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNVEPFVAIPTPREKVA
MEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPN
PLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQEDSPV
IVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTVRNLVLKQGSHTQRVKHY
WYTSWPDHKTPDSAQPLLQLMLDVEEDRLASAGRGPVVVHCSAGIGRTGCFIATSIGCRQ
LREEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgattctttacagattaaaagaaaaatttcagctttccctgagacaagataaagagaaa
aatcaggagatccacctatcacccattgtattacagcctgcacattctgaggacaagaca
gccaacagcatggtccatcctgaacaggctccaaaggtactgagtgtggttgtggaccct
caaggccgatacactcctgagatcaaagctaccacctctgtctgcccttctcctttcaaa
atgaagcccataggacttcaggagaggcgagggtccaacgtatctcttacattggacatg
agtagcttgggcaatgttgaaccctttgtggccataccaaccccacgggagaaggtagcc
atggagtacctgcaatcagccagccgaattctcacaaggtcgcagctgagggacgtcgtg
gcaagttcacacttactccaaagtgaattcatggaaataccaatgaactttgtggatccc
aaagaaattgacattccacgtcatggaaccaaaaatcgctataagaccattttgccaaat
cccctcagtagagtatgtttaagaccaaaaaatgtaactgattctttgagcacttacatc
aatgctaattatattaggggctacagtggcaaagagaaagcattcatcgccacacagggc
cccatgatcaacaccgtgaatgatttctggcagatggtttggcaggaggacagtcccgtg
attgttatgatcacaaaactcaaggagaaaaatgagaaatgtgtgctttattggccagaa
aagagaggaatatatggaaaagttgaggttctggttatcagtgtaaatgaatgcgataac
tatactgttcgaaaccttgtcttaaagcaaggaagtcacacccaacgtgtgaaacattac
tggtacacctcatggcccgatcacaagactccagacagtgcccagccccttctgcagctc
atgctggatgtggaagaagacagacttgcctccgcgggccgagggcctgtggtggttcac
tgcagtgcagggataggtaggacggggtgttttattgctacatccattggctgtcgacag
ttgagagaagaaggagttgtggatgcgctgagcatcgtctgccagctgcgtgtggacagg
ggtggaatggtccaaaccagcgagcagtatgaatttgtgcatcacgctctgtgcctgtac
gagagcagactttcagcagaaactgtccagtga

DBGET integrated database retrieval system