KEGG   Bos taurus (cow): 536936Help
Entry
536936            CDS       T01008                                 

Gene name
SUV39H2
Definition
suppressor of variegation 3-9 homolog 2 (Drosophila) (EC:2.1.1.43)
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    536936 (SUV39H2)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     536936 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
13
AA seq 410 aa AA seqDB search
MAAAGAEAPGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKD
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFFNDKHNYLSQVKKGKAITLKENHRALK
PAVAEYIVKKAKQRIALQRWQDELNRRKTHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCTDCFFEKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCP
NRIVQKGTQYSLCIFRTSNGCGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQLYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDVSSDSIDHSPAKKRARTVCKCGAVTCRGYLN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccggggccgaggcgccaggagcttggtgtgtgccttgcctagtttcactt
gatactcttcaggaattatgtagaaaagaaaagctcacatgtaaatcgattggaatcacc
aaaaggaatctaaacaattatgaggtggaatacttgtgtgactacaaggtagtaaaggat
atggaatattatcttgtaaaatggaaaggatggccagattctacaaatacttgggaacct
ttgcaaaatctcaagtgcccattactacttcagcagttctttaatgacaagcataattat
ttatctcaggtaaagaaaggcaaagcaataactctaaaagaaaatcacagagccttgaaa
cctgctgttgctgaatacattgtaaagaaggctaaacaaaggatagccctgcagagatgg
caggatgaactcaacagaaggaagactcacaaaggaatgatttttgttgaaaatactgtg
gacttagaggggcccccttcagacttctactacattaatgaatacaaaccagctcctgga
atcagcttagtaaatgaagctacctttggttgttcatgcacagattgcttctttgaaaaa
tgttgtcctgctgaagctggagttcttttggcttataataaaaatcaacaaattaaaatc
ccacctggtacccccatttatgagtgcaactcaagatgtcaatgtggacccgactgtccc
aacaggatcgtacaaaaaggcacacagtattcactttgcatctttcgaactagcaatggc
tgtggctggggtgtaaaaacccttgtgaagattaaaagaatgagttttgtcatggaatat
gttggagaggtgatcaccagtgaggaagctgagagacgtggccagttatatgacaacaaa
ggaatcacgtatctctttgatctggactatgaatctgatgaattcacagtggatgcagct
cgatatggaaatgtgtctcattttgtgaatcacagttgtgacccaaaccttcaggtgttc
aatgttttcattgataacctcgatacccgtcttccccgaatagcattattttccacgaga
actatcaatgctggagaagagctcacttttgattatcaaatgaaaggttctggagatgta
tcttcagattctattgaccacagcccagccaaaaagagggccagaactgtgtgcaaatgt
ggagctgtgacttgcagaggttacctcaactga

DBGET integrated database retrieval system