KEGG   Bos taurus (cow): 536960Help
Entry
536960            CDS       T01008                                 

Gene name
CYB5R2
Definition
cytochrome b5 reductase 2
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bta  Bos taurus (cow)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    536960 (CYB5R2)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     536960 (CYB5R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 273 aa AA seqDB search
MKSRHITLQNSDTKYPLPLIEKEQISHNTRRFRFGLPSLDHALGLPVGNYVHLLAEIDGV
LVVRAYTPVSSDDDLGFVDLIIKIYFKNVHPNYPEGGKMTQYLENMKIGDTILFQGPSGC
LFYHGSGKFVFKPYKTSEPETKLVHHLGMIAGGTGITPMLQLIRCIARKPSDKTVMSLIF
ANQTEEDILMRNELEEIARTHPTQFNLWYTLDRPPVDWKYSSGFITKDMIKEHLPPPGKS
TLILVCGPLPLIQTAAHPNLKKLGYTKDMIFTY
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtcgtcacatcaccttacagaactctgataccaagtacccgctgcctttgatt
gagaaagagcaaatcagccacaacactcggaggttccgctttggactgccctccctggac
catgccttagggcttcctgtaggtaactatgttcatctcttggccgaaattgacggtgtt
ctggtggtcagggcttacacgcctgtgtccagtgatgacgacctaggctttgtggactta
atcatcaagatctacttcaaaaatgtacatcctaattacccagaaggggggaagatgact
cagtacttggagaacatgaaaattggggacaccatcctttttcaagggccatctgggtgc
ctgttctatcatgggtcagggaagtttgtattcaagccatacaaaacgagtgagcccgaa
actaaactggtgcatcacctgggaatgattgctgggggcacagggatcacgcctatgctg
cagctcatccgctgcatcgccaggaagcccagtgacaagaccgtgatgtccctcatcttc
gccaaccagacagaggaggatatcttgatgagaaacgagctggaagaaattgccagaact
catccaacgcagttcaacctgtggtacacgctggacaggcctcctgttgactggaagtac
agctcaggcttcattaccaaggacatgatcaaggagcacctccctcctcctggaaagtcc
acgctcatcctggtgtgtggcccactgcccctgatccagacagctgcgcaccctaacctg
aagaaactgggttataccaaggacatgattttcacctactaa

DBGET integrated database retrieval system