KEGG   Bos taurus (cow): 536960Help
Entry
536960            CDS       T01008                                 

Gene name
CYB5R2
Definition
cytochrome b5 reductase 2
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bta  Bos taurus (cow)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bta00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 273 aa AA seqDB search
MKSRHITLQNSDTKYPLPLIEKEQISHNTRRFRFGLPSLDHALGLPVGNYVHLLAEIDGV
LVVRAYTPVSSDDDLGFVDLIIKIYFKNVHPNYPEGGKMTQYLENMKIGDTILFQGPSGC
LFYHGSGKFVFKPYKTSEPETKLVHHLGMIAGGTGITPMLQLIRCIARKPSDKTVMSLIF
ANQTEEDILMRNELEEIARTHPTQFNLWYTLDRPPVDWKYSSGFITKDMIKEHLPPPGKS
TLILVCGPLPLIQTAAHPNLKKLGYTKDMIFTY
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtcgtcacatcaccttacagaactctgataccaagtacccgctgcctttgatt
gagaaagagcaaatcagccacaacactcggaggttccgctttggactgccctccctggac
catgccttagggcttcctgtaggtaactatgttcatctcttggccgaaattgacggtgtt
ctggtggtcagggcttacacgcctgtgtccagtgatgacgacctaggctttgtggactta
atcatcaagatctacttcaaaaatgtacatcctaattacccagaaggggggaagatgact
cagtacttggagaacatgaaaattggggacaccatcctttttcaagggccatctgggtgc
ctgttctatcatgggtcagggaagtttgtattcaagccatacaaaacgagtgagcccgaa
actaaactggtgcatcacctgggaatgattgctgggggcacagggatcacgcctatgctg
cagctcatccgctgcatcgccaggaagcccagtgacaagaccgtgatgtccctcatcttc
gccaaccagacagaggaggatatcttgatgagaaacgagctggaagaaattgccagaact
catccaacgcagttcaacctgtggtacacgctggacaggcctcctgttgactggaagtac
agctcaggcttcattaccaaggacatgatcaaggagcacctccctcctcctggaaagtcc
acgctcatcctggtgtgtggcccactgcccctgatccagacagctgcgcaccctaacctg
aagaaactgggttataccaaggacatgattttcacctactaa

DBGET integrated database retrieval system