KEGG   Bos taurus (cow): 537054Help
Entry
537054            CDS       T01008                                 

Gene name
POMT2
Definition
(RefSeq) protein O-mannosyltransferase 2
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
bta  Bos taurus (cow)
Pathway
Other types of O-glycan biosynthesis
Mannose type O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    537054 (POMT2)
   00514 Other types of O-glycan biosynthesis
    537054 (POMT2)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     537054 (POMT2)
Glycosyltransferases [BR:bta01003]
 O-Glycan biosynthesis
  O-linked Man type
   537054 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
10
AA seq 752 aa AA seqDB search
MPPAAGGGLAGSELRPRRGRCGSQAARAAGRDVATEAATARSPKRPALPSSRRFEAAGRW
ALLALVTLTSFASRFHRLDQPPHICWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAG
YLSGYDGTFLFQKPGDNYEHHSYMGMRGFCAFLGSMLIPLAYLTVLELSRSLSAALLTAA
LLTFDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNSCANRPFSAPWWFWLSLTGVNLAG
ALGVKFVGLFIILQVGWNTLSDLWHLFGDLSLSMVTLGKHLTARILCLIVLPLALYIATY
AVHFMVLNKSGPGDGFFSSAFQARLSGNNLHNASIPEHLAYGSVITVKNLRMAIGYLHSH
RHFYPEGVGARQQQVTTYLHKDYNNLWIIKKHNSNSDPLDPSLPVEFVRHGDIIRLEHKE
TSRNLHSHYHEAPLTRKHYQVTGYGINGSGDSNDFWRIEVINRKFGNRIKVLRSRIRLIH
LITGCVLGSSGKVLPKWGWEQMEVTCTPYLKETLSSIWNVEDHINPKLPNISLEVLQPSF
PEIMLESHMVMIRGNNGLKPKDNEFTSKPWHWPINFQGLRFSGANDTDFRVYLLGNPVVW
WLNLLSIALYVLSASVFAVAVQRGAHLPVEVEGLSQVLLRGGGQLLFGWMMHYFPFFLMG
RVLYFHHYFPAMLFSSMLTGLLWDTLLRLCAWSLASYPLARCVHVLGILSLLLGTAYSFY
LFHPLAYGMVGPLAQDPRSPMAGLRWLESWDF
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggccgccggcggaggcctggcgggatccgaactgcgcccccggaggggccga
tgtgggtcccaggcggctcgggccgcaggccgggacgtggccacggaggcggctacagcg
cggagccccaaacggcctgctcttccgagctcgcggcgcttcgaggcggccggccggtgg
gccctgctggccctggtgacgctgacgtccttcgccagccgcttccaccgtctggaccag
ccgccgcacatctgttgggatgagactcactttggaaaaatgggaagttactatatcaat
cgcaccttcttctttgatgtgcacccacctctgggaaagatgctgattggtctggctggc
tacctgagcgggtacgatggcacctttttgttccagaagcctggggacaactatgagcat
cacagctacatgggaatgagaggattctgtgcattcctcggctccatgctcatccccttg
gcctacctcaccgtgctggagctgtcccggtctctctcagcagcgctgctcacggccgcc
ctcctcacctttgacacaggatgcctcactctgtcccagtacatcctccttgaccccatc
ttgatgttcttcatcatggctgccatgctgagcatggtcaagtacaactcctgtgccaac
aggcccttctctgccccctggtggttctggctcagcctgaccggcgttaatctggctggc
gctctgggggtcaagtttgttggcctcttcatcatcctgcaagtggggtggaacaccctt
tcagacctttggcacctgtttggagacctcagtctttcaatggtgaccttgggaaaacac
ctgaccgctcgcatcctgtgcctcatagtgctgccactggctctctacattgccacctac
gctgtccacttcatggtgctgaacaaaagcggtcccggtgatggcttcttcagttctgcc
ttccaggcccggctttcaggaaacaaccttcacaacgcgtccatccccgaacacctggcc
tacggctccgtgatcactgtgaagaacctgcggatggccatcggctacctccactcgcac
aggcacttctaccccgagggtgtcggcgcccgccagcagcaggtcaccacctatttgcac
aaggactacaacaacctgtggattattaagaagcataattcgaactcagatcccctagac
ccttcactcccagtggagtttgtgagacatggagacatcattcgactagaacacaaagag
acttctcggaacttgcacagtcactatcacgaggcccccctgacccggaagcactatcag
gtcactggctatggcataaatgggtcaggggactcgaatgacttctggcggattgaggtt
ataaacagaaaatttggaaaccgaatcaaagtgctgagaagtcgaattcgcctcatccat
ctgatcacaggttgtgtcctgggctcctcgggaaaggtcctgcccaagtggggctgggag
cagatggaagtcacatgcacaccatacctgaaggaaaccctcagctccatctggaacgtg
gaggaccatatcaatcccaaattgccaaacatcagcctggaagtgctgcagcccagtttc
cctgagataatgctggagtcccacatggtgatgatccgggggaacaatggcctcaagccc
aaggacaatgagttcacgtccaaaccctggcactggcctatcaactttcagggcctgcgc
ttctcaggggccaatgacaccgacttccgagtgtatctgctgggcaacccggtagtctgg
tggctgaacctgctgagcatcgccctctacgtcctctcagcgagcgtctttgctgtggct
gtgcagaggggcgcgcatctgcctgtcgaggttgaagggctgtcccaggtcctgctgcga
ggaggcgggcagctcctgttcggctggatgatgcattacttccccttcttcctgatgggc
cgggtcctctacttccaccactacttccccgccatgctcttctccagcatgctcacaggc
cttctgtgggacaccctcctgcggctctgtgcctggagcctggcctcctatccgctggcc
agatgcgtgcacgtgctgggcatcctgagcctgctcctgggaactgcctacagtttctac
ctcttccaccctctggcttatgggatggtaggtcccctggcccaggacccccgaagtccg
atggccgggctcaggtggctggaatcgtgggacttttga

DBGET integrated database retrieval system