KEGG   Bos taurus (cow): 537257Help
Entry
537257            CDS       T01008                                 

Gene name
USP32
Definition
ubiquitin specific peptidase 32
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     537257 (USP32)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   537257 (USP32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
19
AA seq 1541 aa AA seqDB search
MGAKESRIGFLSYEEALRRVTDVELKRLKDAFKRTCGLSYYMGQHCFIREVLGDGVPPKV
AEVIYCSFGGTSKGLHFNNLIVGLVLLTRGRDEEKAKYIFSLFASESGSYVIREEMERML
HVVDGKVPDTLRKCFSEGEKVNYEKFRNWLLLNKDAFTFSRWLLSGGVYVTLTDDSDTPT
FYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGLFNAF
DENRDNHIDFKEISCGLSACCRGPLAERQKCECVKHCHKICKRYGEKYQHSFIQVCHIVL
GLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKYDASPVVIEPSS
VLNGGKYSFGTTVHPIEQSEDRIGGGSPSYVNTTEEKFSDNVSSASEASETAGSGFLYSA
TPGTDMCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVTQEPVKATSLTLE
GGRLKRTPQLIHGRDYEMVPEPVWRALYHWYGANLALPRPVIKNSKTEIPELELFPRYLL
FLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIKE
EDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSSKID
RHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHM
AKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLNR
VHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKTCGHISVRF
DPFNFLSLPLPMDSYMHLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLSDLCGLKSEQ
ILLAEVHGSNIKNFPQDNQKVRLSVSGFLCAFEIPIPGSPISASSPIQTDFSSSPSTNGM
FTLTANGDLPRPIFIPNGMPNTVVPCGTEKNFTNGMVNGHMPSLPDSSFTGYIIAVHRKM
MRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPLPPQEASNHAQ
DCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCGEDRAFIGNAYIAVDWDPTA
LHLRYQTSQERVVDEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCKTHC
LATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLVPRAPALCQRR
PLTPQGDDLSEPRIPTGEVKKADAQNSAGEDVVLLSKSPSSLSANIVSSPKGSPSTSRKS
GTSCPSSKNSSPNSSPRTLGRSKGRLRLPQIGSKNKLSSSKENLDASKENGAGHVCELSD
ALSRGHVLGGSQPELVTPQDHEVALANGFLYEHEACGNGYSNGQLENHSEEDSTDDQRED
IHVKPIYNLYAISCHSGILGGGHYVTYAKNPNSKWYCYNDSSCKELHPDEIDTDSAYILF
YEQQGIDYAQFLPKIDGKKMADTSSMDEDFESDYKKYCVLQ
NT seq 4626 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaaggagtcacggatcggattcctcagctacgaggaggcgctgaggagagtt
acagatgtcgagctgaaacgactgaaagatgccttcaagaggacttgtggactctcgtat
tacatgggccagcactgcttcatcagggaagtgcttggagatggagtgcctccaaaagtt
gccgaggtgatttactgttcttttggtggaacatccaaaggactacacttcaataactta
atagttggacttgtccttcttacaagaggcagagatgaagagaaagcaaaatacattttt
agtctttttgcaagtgaatccgggagctatgttatacgggaagaaatggaaagaatgctt
catgtggtggatggtaaagtcccagatacactcaggaagtgtttctcagagggtgaaaag
gtaaactatgaaaagtttagaaattggcttcttctaaacaaagatgcttttaccttctct
cgttggctactgtctggaggtgtatatgtgaccctcactgatgatagtgatactcccact
ttctaccaaactctggctggagtcacacatttggaggaatcagacatcattgatctggag
aaacgctattggttgctgaaggctcaatcccgaactggacgattcgatttagagacattt
ggcccattggtttcaccaccaattcgtccatctctaagtgaaggtttgtttaatgctttt
gatgaaaatcgtgacaatcacatagattttaaggagatatcctgtgggttatcagcctgt
tgcagaggacctcttgctgaaagacaaaaatgtgagtgtgttaaacattgtcacaaaatt
tgcaaacgatacggagaaaaatatcagcattcattcatccaggtatgtcacatagttctg
gggttaagaccagctactccagaagaggaaggacaaattattagaggatggttagaacga
gaaagcaggtatggtctgcaaccaggacacaattggtttatcatctctatgcagtggtgg
cagcagtggaaagaatatgtcaaatatgatgccagccctgtggtgattgagccatcatct
gtgctgaatggaggaaaatactcatttggaacaacagtacatcctatagagcagagtgaa
gatagaattggaggaggcagcccaagttatgtgaacaccaccgaagaaaaattttcagac
aacgtttctagtgcatctgaagcctcagaaactgctggcagtggttttctgtattctgcc
acaccaggaacagacatgtgctttgctcgacaacataacacttctgacaataacaaccag
tgtttactaggagccaatgggaatattttgttgcacctcaatcctcagaagccaggggct
attgataaccagccactagtaactcaagaaccagtaaaggctacatcattaacactagaa
ggaggacgattaaaacgaaccccacagctgatccatggaagagattatgagatggttcca
gaacctgtatggagagcactttatcattggtacggagcaaacctggccctacctagacct
gtgatcaaaaatagcaagacagaaatcccagaactggaattgtttcctcgctatcttctc
ttcctgagacagcagcctgccactcggacacagcagtctaacatctgggtgaatatggga
aatgtcccttctccgaatgcaccattaaagcgggtcttagcctatacaggctgttttagt
cgaatgcagaccatcaaggaaattcatgaatatctatctcagaggctgcgcatcaaagag
gaagatatgcgcctgtggctatacaacagtgagaattacctcactcttctggatgatgag
gatcacagattggaatatttgaaaatccaggatgagcagcacctggtaattgaagttcgc
aacaaagatatgagttggcctgaagaaatgtcctttatagcaaacagtagtaaaatagat
agacacaaggttccgacagaaaagggggccacaggtctgagtaacctgggaaatacatgc
ttcatgaattcaagcatccagtgtgttagtaacacgcagccactgacacagtattttatc
tcagggagacatctttatgaactcaacaggacaaatcccattggtatgaaggggcatatg
gctaaatgctatggggatttagtacaggagctttggagtggaactcagaaaaatgtcgcc
ccattaaagcttcggtggaccatagcaaaatatgctcccaggtttaatgggttccagcaa
caagactcccaagaacttctggcttttctcttggatggtctgcatgaagatctcaaccga
gtccatgagaagccatatgtggaactgaaggacagtgatggcagaccagattgggaagta
gctgcagaggcctgggataatcatctaaggagaaatagatcaattgttgtggatttgttc
catgggcagctaaggtcccaagtcaaatgcaagacatgtggacatataagtgtccgattt
gaccctttcaattttttgtctttgccactaccaatggacagttacatgcacttagaaata
acagttattaagctggatggtactacccctgtacgatatggactaagactgaatatggat
gaaaagtacacaggtttaaaaaaacagctgagtgatctctgtggacttaaatcagaacaa
atcctccttgccgaagtacatggttccaacataaagaatttccctcaggacaaccagaaa
gtacggctctcagtgagtggatttttgtgtgcatttgaaattcccatccctggatctcca
atttcagcttctagtccaatacagacagatttctcctcctccccatctacaaacggaatg
ttcaccctgactgccaacggggacctgcctcgaccaatattcattcccaatggaatgcca
aacactgttgtgccatgtggaactgagaaaaacttcacaaatggaatggtgaatggtcat
atgccatctcttcccgacagttcctttacaggctacatcattgcagtccaccggaaaatg
atgagaacagaactgtatttcctgtcatctcagaagaatcgccccagcctttttggaatg
cctctgattgttccatgtacagtgcatacccggaagaaagacctgtatgatgcggtttgg
attcaagtgtcacgattagccagcccactcccacctcaggaagctagtaatcatgctcag
gattgtgatgacagtatgggttatcagtatccattcactctacgagttgtgcagaaagat
gggaactcctgtgcttggtgcccatggtacagattttgcagaggctgcaaaattgattgt
ggggaagacagggctttcattggaaatgcctatattgctgtggattgggaccccacagcc
cttcacctccgctatcaaacatcacaggaaagggttgtagatgagcacgagagtgtggaa
cagagtcggcgtgcacaagctgagcccatcaacctggacagctgtctccgagctttcacc
agcgaggaggagctgggggagaatgagatgtactactgctccaagtgtaagacccactgc
ttggcaaccaagaagctagatctctggaggcttccccccatcctgattattcatctcaaa
cgatttcagtttgtaaatggtcgatggataaaatcacagaaaattgttaagtttcctcgt
gaaagttttgaccctagtgcttttctggtgccgagggccccagctctctgtcagcgtaga
ccactcacaccccagggggatgacctctctgagcccaggatcccgacaggagaggtgaag
aaagcagacgctcagaactccgctggggaagatgtcgtgctcctgagtaagagcccgtcc
tcactgagtgccaacattgtcagtagtcctaaaggttcaccatctacatcaagaaaaagt
ggaaccagctgtccctccagcaaaaacagcagccctaacagcagccctaggactttaggg
agaagcaaagggaggctccgcctaccccaaatcggcagcaaaaacaaattgtcaagtagt
aaggagaacttggatgccagcaaagagaacggggctgggcacgtttgtgagctgtctgat
gccttgagccgagggcacgtgctggggggcagccagcctgagctggtcaccccacaggac
cacgaagtagctttggccaatggattcctttatgagcatgaggcatgtggcaatggctac
agcaatggtcagcttgaaaaccacagtgaagaagacagtactgacgaccaaagagaagat
attcatgttaaacctatttataacctatatgcaatttcgtgccattcaggaattctgggc
gggggccattacgtcacttatgccaaaaacccaaatagcaagtggtactgttacaatgac
agcagctgtaaggaacttcaccctgatgaaattgacaccgactctgcctacattcttttc
tatgagcagcaggggatagactatgcacaatttctgccaaagatcgatggcaaaaagatg
gcagacacaagcagcatggacgaagacttcgagtctgattacaaaaagtactgcgtgtta
cagtga

DBGET integrated database retrieval system