KEGG   Bos taurus (cow): 537301Help
Entry
537301            CDS       T01008                                 

Gene name
APOA4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
bta  Bos taurus (cow)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Class
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:bta04975]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:bta04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
15
AA seq 380 aa AA seqDB search
MFLKAVVLSLALVAVTGAEAEVNADQVATVIWDYFSQLGNNAKKAVEHIQKSELTQQLNT
LFQDKLGEVSTYTDDLQKKLVPFATELHERLTKDSEKLKEEIRKELEDLRARLLPHATEV
SQKIGDNVRELQQRLGPYAEELRTQVDTQAQQLRRQLTPYVERMEKVMRQNLDQLQASLA
PYAEELQATVNQRVEELKGRLTPYADQLQTKIEENVEELRRSLAPYAQDVQGKLNHQLEG
LAFQMKKHAEELKAKISAKAEELRQGLVPLVNSVHGSQLGNAEDLQKSLAELSSRLDQQV
EDFRRTVGPYGETFNKAMVQQLDTLRQKLGPLAGDVEDHLSFLEKDLRDKVSSFFNTLKE
KESQAPALPAQEEMPVPLGG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgaaggctgtggtcctgagcctggccctggtggctgtcaccggagccgaggcg
gaggtcaatgccgaccaggtggccaccgtgatttgggactacttcagccagctgggcaac
aatgccaagaaggcggtggaacatatccagaagtctgagctcacccagcagctcaacacc
ctcttccaagataaacttggggaagtgagcacctacacggacgacctgcagaagaagctg
gtgccctttgccacggaactgcatgaacggctgaccaaggactccgagaagctgaaggag
gagattcggaaggagctggaggacctgcgggcccggctgctgccccacgccacggaggtg
agccagaagatcggggacaacgtgcgcgagctacagcagcgcctgggaccatacgcagag
gagctgcgcacccaggtcgacacccaggcgcagcagctgcggcgccagctgacgccctat
gtggagcgcatggagaaggtgatgcggcagaacctggaccagctgcaggcctcgctggcg
ccctacgccgaggagctccaggccacggtcaaccagcgcgtggaagagctcaaggggcgc
ctgacgccctacgcggaccagctccagaccaagatcgaggagaacgtggaggaactgcgc
cgcagcctggccccttatgctcaggacgtccaggggaagctcaaccaccagctggagggc
ctggcctttcagatgaagaagcatgccgaggagctaaaggccaagatctcagccaaagcc
gaggagctgcggcaggggctggtgcccctggtcaacagcgtgcatggaagtcagctgggc
aatgccgaggacttgcagaagtcactggccgagctgagcagccgcctggaccagcaggtg
gaggacttccgccgcaccgtggggccctacggcgagaccttcaacaaagccatggtgcag
cagctggacacgctcaggcagaagctgggccccctggcgggggacgtggaagatcacctg
agtttcctggagaaggatctgagggacaaggtcagcagcttcttcaacaccctcaaggag
aaagagagccaggcccccgccctccccgcgcaggaggagatgcccgtcccattggggggc
tga

DBGET integrated database retrieval system