KEGG   Bos taurus (cow): 537301Help
Entry
537301            CDS       T01008                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A4
  KO
K08760  
apolipoprotein A-IV
Organism
bta  Bos taurus (cow)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    537301 (APOA4)
   04979 Cholesterol metabolism
    537301 (APOA4)
   04977 Vitamin digestion and absorption
    537301 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
15
AA seq 380 aa AA seqDB search
MFLKAVVLSLALVAVTGAEAEVNADQVATVIWDYFSQLGNNAKKAVEHIQKSELTQQLNT
LFQDKLGEVSTYTDDLQKKLVPFATELHERLTKDSEKLKEEIRKELEDLRARLLPHATEV
SQKIGDNVRELQQRLGPYAEELRTQVDTQAQQLRRQLTPYVERMEKVMRQNLDQLQASLA
PYAEELQATVNQRVEELKGRLTPYADQLQTKIEENVEELRRSLAPYAQDVQGKLNHQLEG
LAFQMKKHAEELKAKISAKAEELRQGLVPLVNSVHGSQLGNAEDLQKSLAELSSRLDQQV
EDFRRTVGPYGETFNKAMVQQLDTLRQKLGPLAGDVEDHLSFLEKDLRDKVSSFFNTLKE
KESQAPALPAQEEMPVPLGG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgaaggctgtggtcctgagcctggccctggtggctgtcaccggagccgaggcg
gaggtcaatgccgaccaggtggccaccgtgatttgggactacttcagccagctgggcaac
aatgccaagaaggcggtggaacatatccagaagtctgagctcacccagcagctcaacacc
ctcttccaagataaacttggggaagtgagcacctacacggacgacctgcagaagaagctg
gtgccctttgccacggaactgcatgaacggctgaccaaggactccgagaagctgaaggag
gagattcggaaggagctggaggacctgcgggcccggctgctgccccacgccacggaggtg
agccagaagatcggggacaacgtgcgcgagctacagcagcgcctgggaccatacgcagag
gagctgcgcacccaggtcgacacccaggcgcagcagctgcggcgccagctgacgccctat
gtggagcgcatggagaaggtgatgcggcagaacctggaccagctgcaggcctcgctggcg
ccctacgccgaggagctccaggccacggtcaaccagcgcgtggaagagctcaaggggcgc
ctgacgccctacgcggaccagctccagaccaagatcgaggagaacgtggaggaactgcgc
cgcagcctggccccttatgctcaggacgtccaggggaagctcaaccaccagctggagggc
ctggcctttcagatgaagaagcatgccgaggagctaaaggccaagatctcagccaaagcc
gaggagctgcggcaggggctggtgcccctggtcaacagcgtgcatggaagtcagctgggc
aatgccgaggacttgcagaagtcactggccgagctgagcagccgcctggaccagcaggtg
gaggacttccgccgcaccgtggggccctacggcgagaccttcaacaaagccatggtgcag
cagctggacacgctcaggcagaagctgggccccctggcgggggacgtggaagatcacctg
agtttcctggagaaggatctgagggacaaggtcagcagcttcttcaacaccctcaaggag
aaagagagccaggcccccgccctccccgcgcaggaggagatgcccgtcccattggggggc
tga

DBGET integrated database retrieval system