KEGG   Bos taurus (cow): 537703Help
Entry
537703            CDS       T01008                                 

Gene name
MAPK7, ERK-5
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04540  Gap junction
bta04657  IL-17 signaling pathway
bta04722  Neurotrophin signaling pathway
bta04912  GnRH signaling pathway
bta04921  Oxytocin signaling pathway
bta05206  MicroRNAs in cancer
bta05418  Fluid shear stress and atherosclerosis
Module
bta_M00690  MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    537703 (MAPK7)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    537703 (MAPK7)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    537703 (MAPK7)
  Endocrine system
   04912 GnRH signaling pathway
    537703 (MAPK7)
   04921 Oxytocin signaling pathway
    537703 (MAPK7)
  Nervous system
   04722 Neurotrophin signaling pathway
    537703 (MAPK7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    537703 (MAPK7)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    537703 (MAPK7)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     537703 (MAPK7)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   537703 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH Rrn6
Motif
Other DBs
NCBI-GeneID: 537703
NCBI-ProteinID: NP_001092550
BGD-bta: BT22411
Ensembl: ENSBTAG00000001014
UniProt: A5PKJ4
Position
19
AA seq 781 aa AA seqDB search
MAEPLKEDDGEDGSGEPPGPVKAEPAGTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMTVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARVSAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPLPCPGPAPDTIDLTLQPPPPASEPAPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGVSGGPSADPLAGLVLSDNDRSLLERWTRMAQPPAPAPATARPPSPPAGPATQPT
GPLPQPACPPPAPAAGPAAPQTTAASGLLAPQPLVPPPGLPGPSALSVLPYFPSGPPPPD
PGGAPQPSTSESPDVTLVTQQLSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSF
DMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQE
P
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcccctgaaggaggacgacggtgaggacggctccggggagccccccgggccg
gtgaaggcggaacccgctggcaccgccgcctcggtggctgccaagaacttggccctgctg
aaggcgcggtccttcgacgtgaccttcgacgtgggggacgagtacgagatcatcgagacc
attggcaacggggcctacggggtggtgtcctccgcgcgccgccgcctcaccggccagcag
gtggccattaagaagatccctaatgcttttgacgtggtgaccaatgccaagcggaccctc
agagagctgaagatcctcaagcacttcaagcacgacaacatcattgccataaaggacatc
ctgaggcccactgtaccctatggcgagttcaaatctgtctacgtggtcctggacctgatg
gagagcgacctgcaccagatcatccactcctcacagccgctgacactggagcatgtgcgc
tacttcctgtaccagctgctgcggggcctcaagtacatgcactcggctcaggtcatccac
cgcgacctcaagccctccaacctactggtgaacgagaactgcgagctcaagattggggac
tttggcatggcccgtggcctgtgcacctcgcccgctgagcaccagtacttcatgaccgag
tatgtggccactcgctggtaccgcgcccctgagctcatgctctcgctgcacgagtacacg
caggccatcgacctgtggtccgtgggctgcatctttggggagatgctggcccggcgccaa
ctcttcccaggcaaaaactatgtgcaccagctgcagctgatcatgacggtgctaggtacc
ccgtcgccggccgtgattcaggctgtgggagctgagagggtgcgggcctatatccagagc
ctgccaccacgccagcctgtgccctgggagacggtgtacccgggcgccgaccgccaggcg
ctctccctactggggcgcatgctacgttttgagcccagcgcccgtgtctctgcagctgct
gccctccgccaccccttcctggccaagtaccatgaccccgacgacgagcctgactgtgcc
ccgccctttgactttgcctttgaccgtgaagccctcacacgggagcgcattaaggaggcc
attgtggcggagatcgaggacttccatgcacggcgcgagggcatccgccagcagatccgc
ttccagccttccttgcagcctgtggccagtgagcctggctgccccgatgtggaaatgccc
agcccctgggctccgagtggggactgcgccatggagtcccctccgccagccccactgcca
tgccctggccctgcgcccgacaccatcgatctgaccctgcagccgcccccaccagccagt
gaaccagcccctccaaagaaggagggggccatctcagacaacaccaaggctgccctcaag
gctgccttgctcaagtccttgcggagccggctccgagatggccccagtgcccccctggaa
gctcctgagcctcggaagccggtgactgctcaggagcgccagcgggagcgggaggagaaa
cgccgacggcggcaggagcgggccaaggagcgagagaagaggcggcaggagcgggagcgc
aaggagcggggcgcgggggtctcggggggcccctccgctgaccccctggctgggctggtg
cttagcgacaacgaccgcagcctgctggagcgttggactcgcatggcccagccccccgcc
cccgcacccgccacagcccggccccccagccctcccgctggccctgccacccagcccact
gggcccctgccacagccggcctgcccaccccctgcacctgcagctggccctgctgctccc
cagaccaccgccgcctccggcctcctggccccccagccgctggtgccgccccctgggctg
cccggccccagtgccctgagtgttctcccttacttcccctctggcccaccccctccagac
cccgggggggccccacagccctccacatcggagtcacctgacgtcaccctggtgacccag
cagctgtccaagtcacaggtggaggaccctttgccccccgtgttctcgggcacccccaag
ggcagtggagctgggtatggtgttggctttgacctggaggaattcctaaaccagtctttt
gacatgggtgtggctgatgggccacaagacggccaggcagactcagcctcgctctcagcc
tccctgctcgctgactggctcgagggccacggcatgaaccctgctgacatcgagtccctg
cagcgtgagatccagatggattcccccatgctgctggccgacctgcccgacctccaagag
ccctga

DBGET integrated database retrieval system