KEGG   Bos taurus (cow): 538094Help
Entry
538094            CDS       T01008                                 

Gene name
MAPK6
Definition
mitogen-activated protein kinase 6
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 722 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELSSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPIHNNFDIEEVQLDPRALSDVTDEEDVQVDPRKYLDGDREKYLEDPAFDTSYS
TEPCWQYPDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAEKEREKNQGFDFDSFIAGTIQLSSQ
HEAADVVDKLNDLNSSVSQLELKSLISKSVSREKQEKGMANLAQLEALYQSSWDSQFVGG
GEDCFLINQFCCEVRKDEQIEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGNEE
GFLNSSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKH
LN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggctctaggtat
atggacttaaaaccattgggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttactgatccccagagtgtcaaa
catgctctacgcgaaatcaaaattattagaagacttgaccacgataacattgtgaaggtg
tttgaaattcttggtcctagtggaagccagttaacggatgacgtgggctctcttaccgaa
ctgagcagtgtttacattgttcaggaatacatggagacagacttggctaatgtgctggag
cagggccctttactggaagagcacgccaggcttttcatgtatcagctgctgcgtgggctc
aaatacattcactcagcaaacgtgctgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgactttggtcttgcacggatcatggatccc
cattattcccataagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgtcttttactttctcctaataattatactaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaaccctctttgcaggtgcacatgaacttgaacag
atgcagctgattttagaatctattcctgttgtccatgaggaagatcgtcaggagcttctc
agcgtaattccagtttacattagaaatgacatgactgagccacacaaacctttaactcag
ctgcttccaggaattagtcgagaagcactggatttcctggaacaaattttgacattcagc
cccatggatcggttgacagcagaagaagcgctttcccatccttacatgagcatttattct
tttccaatggatgagccaatctcaagtcatccttttcatattgaagatgaagttgatgat
attttgcttatggatgaaactcatagtcacatttataactgggaaaggtaccatgattgt
caattttcagagcatgattggcctatacataacaactttgatattgaggaagttcaacta
gacccaagagctctgtctgatgtcactgatgaagaagatgtacaagttgatcctcgaaaa
tatttggatggagatcgtgaaaagtatttggaggatcctgcttttgacaccagttactct
actgagccttgttggcagtacccagatcatcatgaaaacaaatactgtgatctggagtgt
agccatacttgtaactacaaaacgaggtcatcatcatatttagataacttagtttggaga
gagagtgaagttaatcattattatgaacccaagcttattatagatctttctaattggaaa
gaacaaagcaaagaaaaatctgataagaagggcaagtcaaaatgtgaaaggaatggattg
gttaaagcccagatagctttagaggaagcatcacagcaactggctgaaaaagaaagggaa
aagaatcagggatttgactttgattcctttattgcaggaactattcaacttagttcacaa
catgaggctgctgatgttgttgacaaattaaatgacttgaatagctcagtgtcccaatta
gaattgaaaagtttgatatcaaagtcagtaagccgagaaaaacaggaaaaaggaatggca
aatttggctcaattagaagcattgtatcaatcttcttgggatagccagtttgtgggtggt
ggggaggactgttttctcataaatcagttttgttgtgaggtaaggaaagatgagcaaatt
gaaaaggaaaacacttataccagttacctggacaagttttttagcaggaaagaagatact
gaaatgctagaaactgagccggtagaggatgggaagcttggggagagaggaaatgaggaa
ggatttctgaacagcagtggggagttcctcttcaacaagcagcttgaatccataggcatc
ccacagtttcacagtccagttgggtcaccacttaagtcaatacaggccacattaacacct
tctgctatgaaatcttcccctcagattcctcataagacatacagcagcattctgaaacat
ctgaactaa

DBGET integrated database retrieval system