KEGG   Bos taurus (cow): 538284Help
Entry
538284            CDS       T01008                                 

Gene name
USP15
Definition
(RefSeq) ubiquitin specific peptidase 15
  KO
K21343  ubiquitin carboxyl-terminal hydrolase 15 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Pathway
bta04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    538284 (USP15)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     538284 (USP15)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   538284 (USP15)
Membrane trafficking [BR:bta04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    538284 (USP15)
Ubiquitin system [BR:bta04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    538284 (USP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH Ubiquitin_3 DUSP UCH_1 USP7_C2 USP7_ICP0_bdg CW_binding_1
Motif
Other DBs
NCBI-GeneID: 538284
NCBI-ProteinID: NP_001039895
BGD-bta: BT16214
Ensembl: ENSBTAG00000010428
UniProt: Q2HJE4
Position
5
AA seq 952 aa AA seqDB search
MAEGGAADLDIQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLRDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPDEKETRLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPNVKNSNYCLPSYT
AYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAFQCLSNTPPLTEYFLNDKYQEELNFD
NPLGMRGEIAKSYAELIKQMWSGKYSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLL
DGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHLKRNDSIIVDIFHGLFKSTLVCP
ECAKISVTFDPFCYLTLPLPMKKERTLEVYLVRMDPLTKPMQYKVVVPKIGNILDLCTAL
SLLSGVPADKMIVTDIYNHRFHRIFAMDENLSSIMERDDIYVFEININRTEDTEHVIIPV
CLREKFRHSSYTHHTGSSLFGQPFLMAVPRNNTEDKLYNLLLVRMCRYVKISTDTEDTEG
SLHCCKDQNINGNGPNGIHEEGSPSEMETDEPDDESSQDQELPSENENSQSEDSVGGDND
SENGLCTEETCRGQLTGHKKRLFTFQFNNLGNTDINYIKDDTRHIRFDDRQLRLDERSFL
ALDWDPDLKKRYFDENAAEDFEKHESVEYKPPKKPFVKLKDCIELFTTKEKLGAEDPWYC
PNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDTLVDFPINDLDMSEFLINPN
AGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLF
YQRQDTFSGTGFFPLDRETKGASAATGIPLESDEDSNDNDNDIENENCMHTN
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggcggagcggcagatctggacatccagcgttctgacatcgcgacgctgctc
aaaacctcgctccggaaaggggacacctggtacctagtcgatagtcgctggttcaaacag
tggaaaaagtatgttggctttgacagttgggacaaataccagatgggagatcaaaacgtt
tatcctggacccattgataactctgggcttcttagagatggtgatgcccagtcacttaag
gagcaccttattgatgaattggattacatactgttgccaactgagggctggaacaaactt
gtcagctggtacacattgatggaaggtcaggaaccaatagcacgaaaggtggttgaacag
ggtatgtttgtaaagcactgcaaagtagaagtatatctcacagaattgaagctctgtgaa
aatggaaacatgaacaatgttgtaacacgaagatttagcaaagctgacacaatagataca
attgaaaaggaaataagaaaaatcttcaatattccagatgaaaaggagaccagattgtgg
aacaaatacatgagtaatacatttgaaccactgaataaaccagacagcaccattcaggat
gctggtttataccaaggacaggtgttagtgatagaacagaaaaatgaagatggaacatgg
ccaaggggtccgtctactcctaatgtgaaaaactcaaattattgtctcccatcatatacc
gcttataagaactatgattattcagaacctggaagaaacaatgaacaaccaggcctctgt
ggcctaagtaatttgggaaatacgtgtttcatgaactcagcttttcagtgtttgagcaat
acacctccacttactgaatattttctgaatgataagtatcaagaagaactgaattttgac
aatcccttaggaatgagaggtgaaatagctaaatcttatgctgaattgatcaagcaaatg
tggtctggaaagtacagctatgtcacaccaagagcctttaagacacaagtaggacgtttt
gcacctcagttctctggataccagcagcaggactgtcaagaactattagctttcctatta
gatggactacatgaggatttgaatagaattaggaaaaaaccatatatacaattaaaagat
gctgatggaagaccagataaggtagttgctgaagaagcctgggaaaaccatttaaaacga
aatgactctatcatagtagatatatttcatggcctttttaaatcaactttagtttgtccg
gaatgtgctaagatttcagtaacatttgatcctttttgttacttgacacttccattgccc
atgaagaaggaacgtaccttggaagtttatttagttagaatggatccacttaccaaacct
atgcagtacaaagtggttgtccccaaaattggaaacatacttgatctttgtacagcattg
tctcttttgtcaggcgtacctgcagataagatgatagttactgatatatacaatcataga
tttcacagaatatttgcaatggatgaaaatcttagtagtattatggaacgtgatgatatt
tatgtgtttgagattaacataaataggacagaagatacagagcatgtgattattcctgtt
tgcctgagagaaaaatttagacactcaagttacacccaccatactggttcttcacttttt
ggtcagccttttcttatggctgttccacgaaacaatactgaagataaactctataatctt
ttgcttgtgagaatgtgccgatacgtcaaaatatctactgacactgaagacactgaagga
tccctacactgctgtaaggaccaaaatattaatgggaatggcccaaatggcatccatgaa
gaaggctcaccaagtgaaatggaaacagatgagccagatgatgaatccagccaggatcaa
gaactgccctctgagaatgagaacagtcagtcggaagattcagttggaggagataatgat
tctgaaaatggattatgtactgaagaaacttgcagaggtcaactcacgggacacaaaaag
cgattgtttacattccagttcaacaacttaggcaatactgatatcaactacatcaaagat
gataccaggcatataagatttgatgataggcagcttaggttagatgaaaggtctttcctt
gctttggattgggatcctgatttgaaaaaaagatattttgatgaaaatgctgctgaggat
tttgaaaaacacgaaagtgtggaatacaaacctcctaaaaaaccctttgtgaaattaaaa
gattgcattgagctttttacaacaaaagaaaagctaggtgctgaagatccctggtattgt
cccaattgtaaagaacatcagcaagccacaaagaaattggatttatggtctctgcctcca
gtacttgtggtacatctcaagcgattttcttatagtcgatacatgagagacaagttggat
accttagttgattttcctatcaatgatttggatatgtcagaattcctaattaatccaaat
gcaggtccttgccgctataatttgattgccgtttccaaccactatggaggaatgggagga
ggacactatactgctttcgcaaaaaataaagatgatggaaaatggtactactttgatgat
agtagtgtctcaactgcgtctgaagaccagattgtgtccaaagcagcatatgtactcttc
taccagagacaagacactttcagtggaactggctttttcccccttgaccgagaaactaaa
ggtgcttcagctgccacaggcatcccattagaaagtgatgaagatagcaatgataatgac
aatgatatagaaaacgagaactgtatgcacactaactaa

DBGET integrated database retrieval system