KEGG   Bos taurus (cow): 538561Help
Entry
538561            CDS       T01008                                 

Gene name
MGEA5
Definition
meningioma expressed antigen 5 (hyaluronidase)
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
26
AA seq 916 aa AA seqDB search
MVQKESQAALEERESELNSNPAASAGASLEPQAAPAPGEDNPTGAGGAAVAGAAGGARRF
LCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLM
TLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM
CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEK
LLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRS
TELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLE
NEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKASVVDGAPLVAA
PSLNATTVVTTVYQEPIMSQGAALSGEPTALAKDEEKKQPDEEPMDMVVEKQEETDHKND
NQILTEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVP
GPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD
SEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQW
LGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPY
FPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYA
LGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFP
SLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIA
KMEGFPKDVVILGRSL
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaaggagagccaggcggcgctggaggagcgggagagcgagctcaattccaac
cctgccgcctccgcgggggcatcgttggagccgcaggcagctccagccccgggagaagac
aacccaaccggggccgggggagcagcggtcgccggggcggcaggaggggctcggaggttc
ctatgtggcgtggtggaaggattttatggaagaccatgggttatggaacagagaaaagaa
ctctttagaaggctccagaaatgggaattaaatacatatttgtatgctccaaaagatgac
tacaaacataggatgttttggcgagagatgtattcagtggaggaagccgagcaacttatg
actctcatctctgctgcacgggaatatgagatagagttcatctatgctatctcacctgga
ttggatattactttttctaaccccaaggaagtgtctacattgaaacgcaaactggatcag
gtttctcagtttggatgcaggtcatttgccttgctttttgatgatattgaccataatatg
tgtgcagctgacaaagaggtattcagttcttttgctcatgcccaggtctccatcacaaat
gaaatttatcaatacctaggcgagccagaaactttcctcttctgtcccacagaatactgt
ggcactttttgttatccaaatgtgtctcagtctccttacttaaggactgtgggtgaaaag
cttctacctggaattgaggtgctttggacaggtcctaaagttgtttctaaagaaattcca
gtagagtccattgaagaggtttcgaagataattaagagagctccagtaatctgggataac
attcatgctaatgattatgatcagaagagactgtttctgggcccatacaaaggaagatcc
acagaactcatcccacgattaaaaggagtcttgactaatccaaattgtgaatttgaagcc
aactatgttgctatccacacccttgccacctggtacaaatcaaacatgaatggagtaagg
aaagatgtagtgatgactgatagtgaagacagtactgtatcaatccagataaagttagaa
aacgaaggcagtgatgaagatattgaaactgatgtactctatagtccacagatggctctg
aagttagctttaacagaatggttgcaggagtttggcgtacctcatcagtacagcagtagg
caggttgcacacagtggcgctaaagcaagtgtagttgatggggctcctctagttgcagcg
ccctctttaaatgccacaactgtagttacgactgtttaccaggagcccattatgagccag
ggagcagccttgagtggtgagcctacagccctggccaaggacgaagaaaagaaacagcca
gatgaggaacccatggacatggtagtggaaaaacaggaagaaacagaccacaagaatgac
aatcaaatactaactgaaatcgttgaagctaaaatggcagaggaattgaaaccaatggac
actgataaagaaagcatagctgaatcaaaatccccagagatgtctatgcaggaagattgc
atcagtgatattgcccctatgcagactgatgaacagacgaacaaggagcagtttgtgcct
ggtccaaatgaaaagcctttgtacactgcagaaccagtgactctggaggatttgcagtta
cttgctgaccttttctaccttccttatgagcatgggcccaaaggagcgcagatgttacgt
gaattccagtggcttcgagcaaatagcagtgttgtcagtgtcaattgcaaaggaaaagac
tctgaaaaaattgaagaatggcggtcacgagcagccaagtttgaagagatgtgcggacta
gtgatgggaatgttcactcggctctccaattgtgccaacaggacaattctttatgacatg
tactcctatgtttgggatatcaagagtataatgtctatggtgaagtcttttgtacagtgg
ttagggtgtcgtagtcattcttcagcacagttcttaattggagaccaagaaccctgggcc
tttagaggtggtctagcaggagagttccagcgtttgctgccaattgatggggcaaatgac
ctcttttttcaaccacccccactgactcctacctccaaagtttatactatcagaccatat
tttcctaaagatgaggcttccgtgtacaagatttgcagagaaatgtatgacgatggagtt
ggtttaccttttcaaagtcagcctgaccttattggagacaagttagtaggagggctgctt
tcccttagcctggattactgttttgtcctagaagatgaagatggcatatgtggttatgcc
ctgggcactgtagatgtgacccccttcattaaaaaatgtaaaatttcctggattcccttc
atgcaggagaagtataccaaaccaaatggtgataaagaactctctgaggctgagaaaata
atgttgagtttccatgaagagcaggaagtactgccagaaactttccttgccaatttccct
tctctgataaagatggatattcacaaaaaagtaactgatccaagtgtagccaaaagcatg
atggcttgccttctctcttcactgaaagccaatgggtcccgaggggctttttgtgaagtg
agacctgatgataaaagaattttggaattttacagcaagttgggctgttttgaaattgca
aaaatggaaggatttccaaaggatgtggttattcttggtcggagcctgtga

DBGET integrated database retrieval system