KEGG   Bos taurus (cow): 538710Help
Entry
538710            CDS       T01008                                 

Gene name
G6PC
Definition
glucose-6-phosphatase, catalytic subunit (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
bta  Bos taurus (cow)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    538710 (G6PC)
   00052 Galactose metabolism
    538710 (G6PC)
   00500 Starch and sucrose metabolism
    538710 (G6PC)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    538710 (G6PC)
   04151 PI3K-Akt signaling pathway
    538710 (G6PC)
   04152 AMPK signaling pathway
    538710 (G6PC)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    538710 (G6PC)
   04920 Adipocytokine signaling pathway
    538710 (G6PC)
  Digestive system
   04973 Carbohydrate digestion and absorption
    538710 (G6PC)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     538710 (G6PC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 357 aa AA seqDB search
MEKGMNVLHDFGIQSTHYLQVNYQNSQDWFILVSVIADLRNAFYVLFPIWFHLREAVGIK
LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSAPLIKQFPVTCETGPGSPSGHA
MGTAGVYYVMVTSTLSIFRGKKKPTYRFRCLNVMLWLGFWVVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFRHIQSIYNASLKKYFLITCFLFSFAIGFYLLLKWLGVDLLWTLEK
AKRRCERPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWFPFRLSCIV
ASLVLLHLFDSLKPPSQIELIFYVLSFCKSAAVPLASVSLIPYCLAWVLGQPNKKTV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggagaagggaatgaacgttctacatgactttgggatccagtcaacacactacctccag
gtgaattaccagaactcccaggattggttcatcttggtgtctgtgattgcagatctcagg
aatgccttttatgtcctcttccccatttggttccatcttcgagaagctgtgggcatcaaa
ctcctctgggtagctgtgattggagattggctcaacctcgtctttaagtggattctcttt
ggacagcgcccatactggtgggttttggataccgactactacagcaacacctcggcaccg
ctgataaagcagttcccggtcacctgtgagaccggcccagggagtccctctggccacgcc
atgggtacagcaggtgtatactatgtgatggtcacatccaccctctctatctttcgtgga
aagaaaaagccaacctacagatttcggtgcttgaatgtcatgttgtggttgggattctgg
gtcgtgcaactgaatgtctgcctgtcacgaatctaccttgctgctcattttccccatcaa
gttgttgctggagtcttgtcaggcattgcggttgctgagactttccgccacatccagagc
atctacaatgccagtctcaagaagtactttctcatcacctgcttcctgttcagtttcgcc
attggattttacctgctgttaaagtggctgggggtcgacctgctgtggactctagagaaa
gccaagcgaaggtgtgagcggccggagtgggtccacattgatacaacgccctttgccagc
ctcctcaagaatctggggaccctctttggcttgggtctggctctcaactctagcatgtac
cgggagagctgcaagggcaagctcagcaagtggttcccgtttcgcctcagctgcatcgtg
gcctccctcgtcctcctgcacctctttgactctttgaaacccccctcccaaatcgagctg
atcttctatgtcctgtccttctgcaagagtgcagcggtgcccctggcatctgtcagcctc
atcccctactgcctcgcctgggtgctgggccagcccaacaagaagactgtgtaa

DBGET integrated database retrieval system