KEGG   Bos taurus (cow): 538743Help
Entry
538743            CDS       T01008                                 

Gene name
USP8
Definition
ubiquitin specific peptidase 8 (EC:3.4.19.12)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:bta04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
10
AA seq 1085 aa AA seqDB search
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKNYVQSALKIFKTAEESRLDRDEERAY
VLYMKYVTVYNLIKKRPDFMQQQDHFHSILGPANIKKAIEEAERLSESLKLRYEEAEVRK
KLEEKDRQEKEQLQKQKKQEAEREDDSTSDKSSLENVLDAKDKTQKINGEKSEKNETTEK
GAITAKELYTMMMDKNISLIIMDARRMQDYLDSHISDSLSVPEEAISPGVTASWIEANLP
DDSKDTWKKRGSVDYVVLLDWFSSAKDLQLGTTLRSLKDALFKWESKAVLRSEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRGKNEEVSVSLDFTYPSLEESVPSKPTAQMIPPIEISEN
TELINSQDERMGPLNISAPVEPIAASKYDVSPIIQPVPILKNIPQIDRSKKPAIKLPEDH
RIKYESTDHEEQSPQSEKVVPDRSTKPVFPPPTAMLTDEEKARIHAETVLLMEKNKQEKE
LRERQQEEQKERLRREEQEQKDRKEQEAEENEITEKQQKAEQMEKKESEQARKEDKETSA
KRGREITGVKRQSKSEHETTDAKKSVEDRGKRCPTPEVQKRSADVPHASVAGDSSSGKSR
EPLTRARSEEMGRVVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTP
PTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRRPTVTPAVNRENKPTSYPKAE
ITRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNTPHLADYFNRNCYQDD
INRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELL
LFLMDGLHEDLNKADNRKRHKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKST
VQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRD
SLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNL
FSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISISSVKSSAAYILFYTSLGPRI
TDVAT
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccgtggcttcagttcctaaagaactctacctcagttcttcactaaaagacctc
aataagaagacagaagttaaaccagagaaaataagcactaagaattatgtacagagtgcc
ctgaagatcttcaagactgcagaagaaagcagattagatcgtgatgaggaaagggcctat
gtgctatatatgaaatatgtgactgtttataatcttatcaaaaaaaggcctgatttcatg
caacagcaggaccactttcattctatacttggacctgcaaacatcaaaaaagctattgaa
gaagctgagagactctctgaaagccttaaactcagatatgaagaagctgaagttcggaaa
aaacttgaagaaaaggacagacaggagaaagagcagctacagaaacagaaaaagcaggaa
gcagaaagagaggatgatagcacatcagataaaagttctttggaaaatgtactggatgcc
aaagacaaaacccaaaagataaatggtgaaaagagtgaaaaaaatgagactacagagaaa
ggagcaatcacagcaaaggagctatacacaatgatgatggataaaaacatcagcttgatt
ataatggatgctcgtagaatgcaggattatctggattcccatatttcagattctctcagt
gttcctgaagaagccatcagtccaggagtcactgctagttggattgaagcaaacctccca
gatgattctaaagacacatggaagaagagggggagtgtggattatgtggtccttcttgac
tggtttagttctgcaaaagatttacaacttgggacaactctacggagtctgaaagatgca
cttttcaagtgggaaagtaaagctgtcctgcgcagtgaacctttggttttagaaggaggc
tatgaaaactggctcctttgttatccacagtatacaacaaatgctaaagttacgccaccc
ccacgaggcaagaatgaagaggtgtctgtctcattggactttacttacccttcactggaa
gaatcagttccttctaaacctactgcccagatgatacctcctatagaaatcagtgaaaat
acagaattgataaacagtcaagatgagagaatgggaccactgaatatatcagctccagtt
gaaccaattgctgcttctaaatatgatgtttcacccataattcagccagtgcctatttta
aagaatattccacagattgatcgtagtaaaaaaccggcaatcaaattgcctgaagatcat
agaataaaatatgaaagtacagatcatgaggaacagtctcctcagagtgaaaaagttgtt
cctgatcgttccacaaaaccggtatttccccctccaactgctatgctaacagacgaagaa
aaagctcgtattcacgcagaaactgttcttctaatggaaaaaaacaaacaagaaaaagaa
cttagagaaaggcagcaagaggaacagaaagagagactgaggagggaagaacaagaacaa
aaagacagaaaggaacaagaagctgaagaaaatgaaattacagagaagcaacaaaaagca
gaacaaatggaaaagaaagaaagtgaacaggccaggaaagaagataaagaaacttcagca
aagaggggcagagaaataacaggagtaaaaagacaaagtaaaagtgaacatgagactacc
gatgccaagaagtctgtagaagatagggggaagaggtgtccaaccccggaagtgcagaag
aggtcagcagatgtgcctcatgcctctgtggcaggagattcaagttcaggcaagtctcga
gagcctttgacaagagcgagaagtgaagaaatggggagggttgtaccaggactgccgtca
ggctgggccaagtttcttgatcccatcactggaacttttcgttactatcattcgcctacc
aacactgttcatatgtatccaccggaaatggctccttcatctgcacctccttccacccct
ccaactcataaagccaagccacagattcctgctgagcgggatagggaaccgtctaaactg
aagcgctcctactcctccccagatatcacccaggccattcaagaggaagagaagaggagg
ccaacagtaactccagcagttaatcgggaaaacaagccaacaagctatcctaaagctgag
atcacaagactttctgcttctcaaattcggaacctcaatcctgtttttggaggatctgga
ccagctctcactggacttcgtaatttaggaaatacttgttacatgaactcaatattacag
tgcctgtgcaatacgccacatctggctgattatttcaaccgcaactgttaccaggatgat
attaataggtcaaatttgttggggcataaaggtgaagttgcagaagaatttggcataatc
atgaaagccctgtggacgggacagtaccggtacatcagtccaaaagactttaaaatcacc
attgggaagatcaatgaccagtttgcaggatacagccagcaagattcacaagaactgctt
ctgttcctaatggatggtctccatgaagatcttaataaagctgataatcggaagagacat
aaagaagaaaataatgatcatctcgatgactttaaagctgcagaacatgcatggcagaaa
cacaagcagctcaatgaatctatcattgttgcactttttcagggtcaattcaaatccaca
gtacagtgcctcacctgtcacaaaaagtccaggacatttgaggccttcatgtatttgtct
ctcccactagcatctacaagtaaatgtacattacaggattgccttaggttattttccaaa
gaagaaaaactcacagataacaacaggttttattgcagtcattgcagagctcgtcgggat
tccctaaaaaagatagaaatctggaagctgccacctgtgcttttagtgcatctgaaacgt
ttttcctatgatggcaggtggaaacaaaaattacagacatctgtggactttccattagaa
aatcttgacttgtcgcagtatgttattggcccaaagaacaatctgaagaaatacaacttg
ttttctgtttcaaatcactacggtgggctggacggtggccactacactgcctattgtaaa
aatgcagcaagacagcggtggtttaaatttgacgatcatgaggtttctgatatttccatt
tcttcggtgaaatcttcagcagcttatatcctcttttatacgtcactgggaccacgaata
actgatgtagccacgtaa

DBGET integrated database retrieval system