KEGG   Bos taurus (cow): 538785Help
Entry
538785            CDS       T01008                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1 (EC:3.1.2.15)
Orthology
K11867  
AMSH-like protease [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     538785 (STAMBPL1)
Peptidases [BR:bta01002]
 Metallo Peptidases
  Family M67
   538785 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
26
AA seq 436 aa AA seqDB search
MDQPLTVNSLKKLAAMPDHTDVSLTPEERVRALSKLGGNITINEDITPRRYFRSGVEMER
MASVYLEEGNLESAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKKDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFSIF
EDQLKKQELARSQLRSQETPALSEQIDGSALSCFSTHQNSSLLNVLADQSSKSDATSYAG
HSPPVNRALKPAASLSAVQNLVVEGLRCVVLSRDLCHRFLLLAESNTVRGIETCGILCGK
LTHNEFTITHLIVPKQSAGPDYCDVENVEELFSVQDQHDLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTDAGMLEVSACKKKGFHPHTKDPRLFSVC
RHVLVKDIKIIVLDLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatcagccattaactgtgaactccctgaaaaagttagctgcgatgcccgaccacacg
gatgtctccctcaccccagaagaacgagtccgtgccctgagcaagctgggcgggaacatc
accatcaatgaagatatcactccacgccgctactttagatccggagtagaaatggagagg
atggcatctgtgtatttggaagaaggaaacctggaaagtgcatttgtgctttataataaa
tttataactttatttgtagaaaagcttcccaaccatcgagattaccagcaatgtgcagta
cccgaaaagcaagatattatgaagaaactgaaggagattgcattcccaaggacagatgaa
ttgaaaaaggaccttttaaagaaatataacgtagaataccaagaatatttgcaaagcaaa
aacaaatacaaagctgaaatcctcaaaaaactggagcatcagaggttgattgaggcggaa
aggaagaggatcgcccagatgcgccagcagcagctggagtcagagcagttttcgattttt
gaagatcagctcaagaagcaggaattagcccggagtcagctgcgaagccaggaaacgccg
gcactgtcagagcagatcgatggcagcgctttgtcctgcttttccacacaccagaacagt
tccttgctgaacgtacttgcagatcagtctagtaaaagtgatgcaaccagttatgctggc
cactcacctcccgtcaacagggccttaaagccagctgccagtctaagtgctgttcagaat
ttagtggttgaaggactgagatgcgtcgttttatcaagagatctttgccacagatttctg
ctgctggcagaatccaatacagtgagaggaatagaaacctgtggaatactctgtgggaag
ctgacacataatgaatttactattacccacttaatagtgcccaagcagtccgcgggacca
gactattgtgacgtggagaatgtagaagaattattcagtgttcaggatcaacatgatctc
ctcactctggggtggatccatacacatccaacccaaactgcattcttatccagtgttgat
ctccacactcactgttcctatcagctcatgttgccagaggccattgccatcgtctgttca
ccaaagcataaagacaccgggatcttcaggctcactgacgctggcatgcttgaggtttcc
gcttgtaaaaagaagggctttcatccacacaccaaggaccccaggttgttcagtgtatgc
agacatgtattggtgaaagacataaagataatcgtgctggatctgaggtga

DBGET integrated database retrieval system