KEGG   Bos taurus (cow): 538954Help
Entry
538954            CDS       T01008                                 

Gene name
PRKAA2
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
bta  Bos taurus (cow)
Pathway
bta04068  FoxO signaling pathway
bta04140  Autophagy - animal
bta04150  mTOR signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04152  AMPK signaling pathway
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta04371  Apelin signaling pathway
bta04530  Tight junction
bta04710  Circadian rhythm
bta04714  Thermogenesis
bta04910  Insulin signaling pathway
bta04920  Adipocytokine signaling pathway
bta04921  Oxytocin signaling pathway
bta04922  Glucagon signaling pathway
bta04931  Insulin resistance
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05410  Hypertrophic cardiomyopathy (HCM)
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    538954 (PRKAA2)
   04068 FoxO signaling pathway
    538954 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    538954 (PRKAA2)
   04152 AMPK signaling pathway
    538954 (PRKAA2)
   04150 mTOR signaling pathway
    538954 (PRKAA2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    538954 (PRKAA2)
  Cellular community - eukaryotes
   04530 Tight junction
    538954 (PRKAA2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    538954 (PRKAA2)
   04922 Glucagon signaling pathway
    538954 (PRKAA2)
   04920 Adipocytokine signaling pathway
    538954 (PRKAA2)
   04921 Oxytocin signaling pathway
    538954 (PRKAA2)
  Aging
   04211 Longevity regulating pathway - mammal
    538954 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    538954 (PRKAA2)
  Environmental adaptation
   04710 Circadian rhythm
    538954 (PRKAA2)
   04714 Thermogenesis
    538954 (PRKAA2)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    538954 (PRKAA2)
   05410 Hypertrophic cardiomyopathy (HCM)
    538954 (PRKAA2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    538954 (PRKAA2)
   04931 Insulin resistance
    538954 (PRKAA2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     538954 (PRKAA2)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   538954 (PRKAA2)
Membrane trafficking [BR:bta04131]
 Autophagy
  Other autophagy associated proteins
   Others
    538954 (PRKAA2)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    538954 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    538954 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase YukC
Motif
Other DBs
NCBI-GeneID: 538954
NCBI-ProteinID: NP_001192534
BGD-bta: BT22844
Ensembl: ENSBTAG00000018747
Position
3
AA seq 552 aa AA seqDB search
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDSTMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRRNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRPRSSLDSVTAEGHSLSGSLTGSLTGSMSSSVSPRLGSHTMDFF
EMCASLITTLAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaagatcggccactacgtgctgggcgac
acgctgggcgtcggcaccttcggcaaagtgaagattggagagcatcaattgacaggccat
aaagttgcagttaaaattttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatctaaaactctttcgtcatcctcatattatcaaactatac
caggtgatcagcactccaacagatttttttatggtaatggaatatgtgtctggtggtgaa
ttgtttgactacatctgtaaacatggacgggttgaagagatggaagctcggcggctgttt
cagcagattctgtctgccgtggattactgtcacaggcacatggttgttcatcgagacctg
aaaccagagaatgtgctattggacgcacagatgaatgccaagatagctgattttggatta
tctaacatgatgtcagatggtgaatttctgcgaactagctgcggatccccaaattatgca
gcacctgaagtcatctcaggcaggctgtatgcaggtcctgaagtggatatctggagctgc
ggtgttattttgtatgctcttctttgtggcaccctcccatttgatgatgagcatgtgcct
acgctgtttaagaagatccgagggggtgttttttacatcccagaatatctcaatcgttct
gttgctactctcctgatgcatatgctgcaggttgatcccctgaaacgagcaactatcaaa
gacataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gagtgtacagaatcagaagtaatgaacagtttatatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcccccaactggttcttttatggatgatagtaccatgcatattccc
ccaggcctgaaacctcatccggaaaggatgccacctcttatagcagacagccctaaagca
cgatgtccactggatgcactgaatacaacgaagcccaaatctttagctgtgaaaaaagcc
aagtggcatcttggaatccgaagtcaaagcaaaccatatgacattatggctgaagtttac
cgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatctacgtgta
agaagaagaaatccagtgactggcaattatgtgaaaatgagcttacagctgtacctggtt
gacaacagaagctatcttttggactttaaaagcattgatgatgaggtggtggagcagagg
tctggttcctcaacacctcagcggtcctgttctgctgctggcttacacagaccacggtcc
agtttggattctgtaactgcggagggccattcactctctggctctctcacgggctctttg
accggaagcatgtcgtcctctgtctcacctcgcctgggcagtcacaccatggattttttt
gaaatgtgtgccagtctgatcactactttagcacgctga

DBGET integrated database retrieval system