KEGG   Bos taurus (cow): 539034Help
Entry
539034            CDS       T01008                                 

Gene name
PFN2
Definition
(RefSeq) profilin 2
  KO
K05759  profilin
Organism
bta  Bos taurus (cow)
Pathway
bta04015  Rap1 signaling pathway
bta04810  Regulation of actin cytoskeleton
bta05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    539034 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    539034 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    539034 (PFN2)
Membrane trafficking [BR:bta04131]
 Others
  Actin-binding proteins
   Others
    539034 (PFN2)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     539034 (PFN2)
Exosome [BR:bta04147]
 Exosomal proteins
  Proteins found in most exosomes
   539034 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 539034
NCBI-ProteinID: NP_001121669
Ensembl: ENSBTAG00000011150
UniProt: Q09430
Position
1
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc
cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt
accaatggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtg
gacggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacgtacaac
gtggccgtgggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

DBGET integrated database retrieval system