KEGG   Bos taurus (cow): 539042Help
Entry
539042            CDS       T01008                                 

Gene name
ART1
Definition
ADP-ribosyltransferase 1 (EC:2.4.2.31)
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     539042 (ART1)
Cellular antigens [BR:bta04090]
 Proteins
  539042 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 326 aa AA seqDB search
MQSPAVMSLLLVSMGLMEALQAQSHPVIRRDLLSREMPLDMALTSFDDQYAGCATAMAAA
LPELNRTEFQANKVYADGWVQASSQWRERQAWGPEWGVSPTRLLAPLGFREEHGVALLAY
TANSPLHKEFNAAVREAGRSRAHYLQHFSFKTLHFLLTEALQLLSSGQRPPQCHQVFRGV
QGLRFRPAGPGATVRLGGFASASLQDAAAQHFGEDTFFGIWTCLGAPIKGYSFFPGEEEV
LIPPFETFQVINASRPAQGPSRIYLRAVGKRSTYNCEYIKDKQCKSERCRLGNSAVGQSP
LSAVWSLLLLLWFLVGEVFPESPGFL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcagagccctgccgtgatgtctctgttgcttgtgtccatgggcctcatggaagcactt
caggcccagagccaccccgtcatacgacgagacctcctctctcgagaaatgcccctagac
atggccctgacctcctttgatgaccagtatgctggctgtgccacagccatggcagcggct
ctcccggaactcaaccgcacagagttccaggccaacaaagtgtacgctgatggctgggtg
caggcaagcagccagtggcgggagcgccaggcctgggggcccgagtggggcgtcagccct
acccgtctgctcgcccccctgggcttccgagaagagcacggggtggccctcttggcttac
acggccaacagccccttgcacaaagaattcaatgcggccgtgcgtgaggcgggtcgctcc
cgggctcactacctccagcacttctccttcaagacactccacttcctgctgaccgaagcc
ctgcagctgctgagcagcggccagcgtccaccccagtgccaccaggtgttccgaggggtg
cagggcctgcgcttccggccggccgggcctggggccactgtcaggctggggggctttgcc
tccgcgtccctgcaggatgctgcggcccagcactttggggaagacaccttctttggcatc
tggacttgccttggggccccaatcaagggctactccttcttccctggggaggaggaagtg
ctgatccctccctttgagaccttccaggtgatcaacgccagcaggccagcccagggcccc
tcccgcatctacctccgggccgtgggcaagcgcagcacatacaactgcgagtacatcaaa
gacaagcaatgcaagtctgagcgctgccgtctgggtaactcagccgtgggtcagagcccc
ctttctgcagtctggtcccttctactgctgctctggttccttgttggcgaagtctttcca
gagagtccaggcttcctctaa

DBGET integrated database retrieval system