KEGG   Bos taurus (cow): 539052Help
Entry
539052            CDS       T01008                                 

Gene name
EIF3J
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
bta  Bos taurus (cow)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    539052 (EIF3J)
Translation factors [BR:bta03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    539052 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
10
AA seq 256 aa AA seqDB search
MAAAAAGDSDSWDADTFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEE
AEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKK
LQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYANFLEA
LVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLAD
YGGYDGGYAQDYEDFM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggctggggactccgactcctgggacgcggacacgttctcagtggaa
gacccggtgcggaaggtggggggcggcggcactgccggcggggaccgctgggagggcgag
gacgaggacgaggacgtcaaggataactgggatgatgatgatgatgagaaaaaagaagaa
gcagaagtaaaaccagaagtaaaaatttcagaaaagaaaaaaatagcagagaaaataaaa
gagaaagaacggcagcagaagaaaaggcaagaagaaattaaaaagagattagaagaacct
gaagaacctaaagtgctaacaccagaagaacaattagcagataaactgcggcttaagaaa
ttacaggaagagtctgaccttgaattagcaaaagaaacttttggtgttaataatacagtt
tatggaatagacgctatgaacccatcctcaagagatgacttcacagagtttggaaagtta
ctaaaagataaaattacacaatatgaaaagtcactatattatgccaattttttggaagcc
ttagttcgagatgtttgtatttcattggaaattgatgacttgaaaaagattaccaattca
ttgactgtactctgcagtgaaaaacagaagcaagaaaagcagagcaaagccaaaaagaag
aagaaaggtgtggttcccggagggggactaaaggccaccatgaaagacgacctggcggac
tacgggggttacgacggcggatacgcacaggactacgaggacttcatgtga

DBGET integrated database retrieval system