KEGG   Bos taurus (cow): 539121Help
Entry
539121            CDS       T01008                                 

Gene name
MLL5
Definition
myeloid/lymphoid or mixed-lineage leukemia 5 (trithorax homolog, Drosophila) (EC:2.1.1.43)
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    539121 (MLL5)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     539121 (MLL5)
Transcription factors [BR:bta03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    539121 (MLL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
4
AA seq 1859 aa AA seqDB search
MSIVIPLGVDTAETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSVLISKNEVSIFTTPNFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRSLDKERAVLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTSITLTASRVSKVNDKRRKKSGEKEQNISK
CKKAFREGSRKSSRVKGSAPEIDPSSDVSNFGWETKIKAWMDQYEEANNNQYSESVQREA
QRIALRLGNGNDKKEIKSDLNTNNLIFKPPVESHIQKNKKILKSAKDLPPDALIIEYRGK
FMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHEI
EDGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCACLKENSECPVLKRSSESTENI
NSGYETRRKKGKKEKDISKEKDTQNQNITLDCEGTTNKMKSPETKQRKLSPLRLSVSNNQ
EPDFIDDIEEKTPISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQA
LERISTAKTEVKTECKDAQTVSDAEVIQEQAKEETASKPTPAKVNRTKQRKSFSRSRTHI
GQQRRRHRTVSMCSDIQPSSPDIEVTSQQNDVENTVLAIEPETETALTEIITENEVPVLN
KCPTKYPKTKKHLVSEWLSEKNEKTGKPSDSLSERPLRITTDPEVLATQLNSLPGLTYSP
HVYSTPKHYIRFTSPFLSEKRRRKEPPENISGSCKKRWLKQALEEENSAILHRFNSPCQE
RSRSPTVNGENKSPLLLNDSCSLPDLTTPLKKRRLYQLLDSAYSETSTPTPSPYATPTHT
DITPTDPSFSTPPRIKSDDEACRNGYKPIYSPVTPVTPGTPGNTMHFENISSPESSPEIK
RRTYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGYGSPRSRTEISRQCPGEKEPVS
DLQLGLDAVEQTALHKTMEAAAHDRTEAASQLEAAHSGRGPLYSSWVKSPERTGVNFSVN
SNLRDLTPSHQLEVGGGFRISESKCLMQDDTRGMFMETPVFCTSEDGLVSGFGRTVNDNL
IDGSCTPQNPPQKKKVSLLEYRKRQREARKSGSKTEHFALVSVSPHTSGNLSSSTGDGCA
HRSENGEQVESAASLPLPTPATVYHATSEETSNNSTVKEVSASEKNEPEVQWTASTSVEQ
VRERSYQRALLLSDHRKDKDSGAESPCVPCSPNHVPSSPSSHSNHIPQLQPKGPVPSFSE
LTEDPDPENLEPTTTNECPSPDTSQSTCKSPSKMSKPGSPGPVIPVQPHGKILTKPDSHW
EGTVIVSEAENGVHLKTELHQKQLSSNPQALSKNHPPQPLVRCSSEQLSQKLPSAPMKLH
CPPSPHVENPPKSSTPHTPVQHGYLSPKPPTQQLGSPYRPHHSQSPQVGTPQREPQRNFY
PAAQNLQASTQQATSGALFTQTPSGQSSATYSQFNQTSLSSTAPPPPPPPPPSSSSYYQN
QQPSANFQNYNQLKGSLSQQTVFTSGPNQALPGTTSQQTVPGHHVTPGHFLPSQNPTVHH
QTAAAVVPPPPPPPPAPGPHLVQQPSSHQPHSVAHVVGPVHAVTPGSHIHSQTAGHHLPP
PPPPPGPAPHHHPPPHPSTGLQGLQAQHQHVVNSAPPPPPPPPPSSVLASGHHTTSAQAL
HHPPHQGPPLFPSSAHPAVPPYPSQATHHTTLGLGPQHQPSGTGPHCPLPVAGPHLQPQG
PNSIPTPTASGFCPHPGSVALPHGVQGPQQASPVPGQIPIHRAQVPPTFQNNYHGSGWH
NT seq 5580 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagtgatcccattgggggttgatacagcagaaacgtcatacttggagatggct
gcaggctcagaaccagaatccgtagaagctagccctgtggtagttgagaaatccaacagt
tatccccaccagttatataccagcagctcgcatcattcacacagttacattggtttgccc
tatgcggaccataattatggtgctcgtcctcctccaacacctccagcttcccctcctcca
tcagttcttattagcaaaaatgaagtaagcatctttaccactcctaattttgatgaaact
tccagtgctactacaatcagcacatctgaggatggaagttatggtactgatgtaaccagg
tgcatatgtggttttacacatgatgatggatacatgatctgttgtgacaaatgcagtgtt
tggcaacatattgactgcatggggattgacaggcagcatattcctgatacatatctttgt
gaacgttgtcagcctaggagtttggataaagagagggcggtgctactacaacgccggaaa
agggaaaatatgtcagatggtgataccagtgcaactgagagtggtgatgaggttcctgtg
gaattatatactgcatttcagcataccccaacatcgattactttaactgcttcaagggtt
tctaaggttaatgataaaagaaggaaaaaaagtggggagaaagaacaaaatatttcaaaa
tgtaaaaaagcctttcgtgaaggatctaggaaatcatcaagagttaagggctcagctccg
gagattgatccttcatctgatgtttcaaattttggatgggagacaaaaatcaaagcatgg
atggatcaatatgaagaggcaaataataaccaatatagtgagagtgttcagagggaggca
caaagaatagctctgagattgggcaatggaaatgacaaaaaagagattaaatcagatttg
aataccaacaatttgatcttcaaacctcctgtagagagccatatacaaaaaaataagaag
attctgaaatctgcaaaagatttgcctcctgatgcacttatcattgaatacagagggaag
tttatgttgagagagcagtttgaagcaaatggatatttctttaagagaccataccctttt
gttttattctattctaaatttcatggcctagaaatgtgtgttgatgcaaggacttttggg
aatgaagctcggttcatcaggcgttcttgtacacccaatgcagaggtgaggcatgaaatt
gaagatggaaccatacatctttatatttattctatacaaagtattccaaagggaaccgaa
attactattgcctttgattttgactatgggaattgtaagtacaaggtggattgtgcatgc
ctcaaagaaaattcagagtgccctgttctgaaacgtagttctgaatccacggagaacatc
aatagcggttatgagaccagaaggaagaaaggcaaaaaagaaaaggatatttcaaaagaa
aaagacacacaaaatcagaatattactctggattgtgaaggaacaacgaacaaaatgaag
agcccagaaactaaacagagaaagctttctccactgagactatcagtatcaaataatcag
gaaccagattttattgatgatatagaagaaaaaactcccatcagcaatgaggtagaaatg
gagtctgaggaacagattgcagagaggaaaaggaagatgacaagagaagaaaggaaaatg
gaagcaattctgcaggcttttgccagacttgaaaaaagagagaagagaagagaacaagct
ttggaaagaatcagcacagccaaaactgaagttaaaactgaatgtaaagatgcacagact
gtcagtgatgctgaagttattcaggaacaagcaaaagaagaaactgctagcaagccaacc
ccagccaaagtaaatagaactaaacagagaaaaagtttttctcggagcaggactcacatt
ggacagcagcgtcggagacacaggactgtcagtatgtgttcggatatccaaccgtcttct
cctgacatcgaagttacctcacaacaaaacgatgtggaaaatactgtacttgcaatagaa
ccagaaactgaaactgcactaacagaaataattactgaaaatgaagttccagtacttaat
aaatgtccaacaaagtaccctaaaacaaagaagcacttggtcagtgaatggttaagtgag
aagaatgagaagacaggaaaaccttcagacagcctttcagagaggccgctgcgcataact
acagatcctgaagtgctagctacacagctcaattctttgccaggtctcacttacagtcca
catgtatactctactcctaagcactatattagattcacttcaccattcctttcggaaaaa
aggagaagaaaagaacctcctgaaaacatatctggctcatgcaagaagcggtggttgaaa
caagctctggaagaggaaaactcagcaattttacatagatttaattcgccctgtcaagaa
agatccagaagtcctacagtcaatggtgaaaataaaagtccactactattaaatgatagc
tgttcccttccagatttaactacaccactgaaaaaacgaagactttatcagttgctagat
tctgcttactcagaaacctccacacctactccttcaccgtatgctacaccaactcacaca
gatattactcctacagacccatcattttccactcctccacggataaagtcagatgatgaa
gcttgtagaaatggttataagcccatatattcaccagttaccccagtaactcctggcaca
ccaggaaataccatgcactttgagaatatttcttccccagaaagttctccagaaattaag
agacgcacttatagtcaagagggatatgacagatcgtcaaccatgttaacgttggggcct
tttagaaattctaacttaactgaactgggtctgcaagaaataaagactattggctatggc
agccctaggagtaggactgaaatcagcaggcagtgccctggagaaaaggaaccggtgtca
gatcttcaactgggactcgatgcagtcgagcagaccgccttacataaaaccatggaagca
gctgcacacgacaggactgaggctgccagccagctggaggctgctcactcggggcggggc
cctctgtattcctcctgggtaaagagtcctgagagaacaggcgttaacttctcagtaaat
tccaacttgagggacctgacaccctcacatcagttggaggttggaggcggcttccgaata
agtgagtcaaagtgcctgatgcaggatgatactagaggcatgtttatggaaacacccgtg
ttttgtacttcagaagatgggcttgtatctggtttcggacggactgttaatgacaatttg
atcgacggaagttgcacaccccagaatccaccacaaaagaaaaaggtttctctattagaa
taccggaagagacaacgtgaagctaggaagagcggctctaagacggagcactttgcgctg
gttagtgtatcacctcacacaagtggcaacttgagcagcagcactggtgatgggtgtgcc
cacaggagtgaaaatggggagcaggtagaaagcgctgctagcctacctttaccaacacca
gctacagtttatcatgctacttcggaagaaaccagcaataacagtactgttaaggaagtg
tctgccagtgaaaagaatgaaccagaagttcaatggacggcctcaacttcagtggagcaa
gtgagagagaggagttatcagagagctctgcttctcagtgatcaccgaaaagataaagac
agtggggcagagtcaccatgtgtcccctgttcaccgaatcatgttccgtcttctccttca
tctcattcaaatcacattccccagttgcaacccaagggcccagtcccttctttcagtgaa
cttacggaagatcctgatcctgaaaatctagaacccacaactacaaatgaatgcccatcc
ccagatacttcccaaagtacttgtaaaagtccttcaaaaatgagcaagcctggttcacct
ggacctgtaattcctgttcagccacatgggaaaatacttacaaaaccagattcccattgg
gagggaacagttattgtatctgaagctgagaatggtgtccacctgaaaacagaactccat
caaaaacagctgtcaagtaacccccaagcactttcaaagaaccatcctccacagccactc
gttcgctgttcatctgagcagctttcacaaaagctgccttctgcacccatgaagttgcac
tgtcctccgtcacctcacgtagaaaatcctccaaagtcatcgacgcctcacacgcctgta
cagcatggctatctctcaccaaagccgcctacacagcagttaggctctccctataggcct
caccattcacagtcacctcaagttggaacacctcagcgagagcctcaaagaaatttttac
ccagccgcacagaaccttcaagccagtactcagcaggcaacttctggagcattatttaca
cagacaccctcaggacaatcttcagcaacatacagtcagtttaatcagacaagtctgagc
agcacggcaccaccccctccaccccctccacccccttcttcttcgtcttattatcaaaac
cagcagccctctgcaaactttcagaattataatcagcttaaaggtagtctttcccaacaa
actgtgtttacatcaggaccaaatcaagcacttcctggcaccacaagccagcaaacagtt
ccaggacaccacgttactccagggcattttttgccttctcagaaccctactgttcaccat
cagactgctgctgctgtggtcccaccccctcctccacccccacctgctccaggaccacac
ctcgtacaacagccaagctcccatcagccacactcagtagcacatgtggtggggcctgtt
cacgctgtcacccctggatcgcatattcattctcaaactgctgggcaccatttgccacca
ccgcctccccctcctggtcctgcccctcatcaccaccccccgccccacccttccacagga
ctccaaggtctacaagcacaacaccagcatgtggtaaactcagcccctccacctccccct
cctcctccgccttccagtgttctggcttctgggcatcacaccacgtcagctcaagcctta
caccatccacctcatcaaggaccgccactttttccttcaagtgctcatccagctgtacca
ccgtatccctcacaagctacacatcacaccactctgggactgggaccccaacaccagcct
tctggaacagggccacattgtccattaccagttgcaggtcctcatctccagccccaagga
ccaaacagtattccaacacctaccgcttcagggttctgtcctcaccctggctctgtggcc
ctgccacatggggtccaaggacctcagcaggcatctccagtgcctggacagattccaatt
cacagagcacaggtgccaccgacatttcagaacaattaccatggttcggggtggcattaa

DBGET integrated database retrieval system