KEGG   Bos taurus (cow): 539145Help
Entry
539145            CDS       T01008                                 

Gene name
OTUD5
Definition
OTU domain containing 5 (EC:3.1.2.15)
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    539145 (OTUD5)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     539145 (OTUD5)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   539145 (OTUD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
X
AA seq 571 aa AA seqDB search
MTILPKKKPPPPDGDPANEPPPPGPLPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGTA
ATGVGAAGVVVGVGGAVGVGGCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTGTSVVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFA
EQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQ
VRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPGT
VLALAKPPSPCAPGTSSQFSTGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDE
ILASVLAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgactattctccccaaaaagaagccgccgcctcccgacggcgaccccgccaacgagccg
ccgccgcccggaccgctgcccccggcgcctcgccgcggcgggggtgtaggcgtgggcggc
ggcggcacgggtgtgggcggcggcgaccgcgaccgtgactcgggcgtcgtgggggcccgt
cctcgggcttcgccaccgcctcaaggccctctcccagggccaccgggtgcgcttcaccgc
tgggcgctggccgtgccgcccggcgccgtggcgggtcctcggccacagcaggcctctcca
cctccttgcgggggccccggaggtcccggcggcggtcctggtgatgcgttgggtacagca
gcgacgggcgtgggcgcggcgggtgtggtggtgggcgtgggcggtgccgtgggtgtgggc
ggctgctgctcagggccgggtcacagcaagcggcggcgtcaggcccccggggttggtgcg
gttggcgggggcagtcctgagcgtgaggaggtcggcgcaggttacaacagtgaggatgaa
tatgaagcggctgcagcgcgcatagaggccatggaccccgccaccgtcgagcagcaggag
cactggtttgaaaaggccttgcgagacaagaagggcttcatcatcaagcagatgaaggag
gatggtgcctgtctcttccgggctgtagctgaccaggtatatggagaccaggacatgcat
gaggttgttcgaaagcactgcatggactatctgatgaagaatgctgactacttctccaac
tatgtcacagaggactttaccacctacatcaaccggaagcggaaaaacaactgccatggc
aaccacattgagatgcaggccatggcagagatgtacaaccggcccgtggaggtgtaccag
tacagcacaggtacttctgtggtggaacccattaatacattccatgggatccatcaaaat
gaggatgaacccattcgtgtcagctaccataggaatatccactacaactcagtagtgaat
cctaacaaggccaccattggcgtgggactgggcctgccatcattcaaaccggggtttgca
gagcagtccctgatgaagaatgccataaaaacatcagaggaatcatggattgaacagcag
atgctggaagacaagaagcgggccacagattgggaggccacaaatgaggccattgaggag
caggtggcccgggaatcctacttgcagtggctgcgggatcaagaaaaacaggctcgccaa
gtccgtggccccagccagccccggaaagccagtgccacatgcagctctgccacagcagca
gcctccagcggtcttgaggagtggaccagccggtccccaaggcagcggagttcagcgtcg
tcacctgagcaccctgagctgcatgctgagctgggcatcaagcccccttccccaggcact
gtcttagctcttgccaaacctccttcaccctgtgcaccaggtacaagcagccagttctcg
acaggggccgaccgggctacttcccccctcgtgtccctctaccctgctctggagtgccgg
gccctcattcagcagatgtccccctctgcctttggtctgaatgactgggatgatgatgag
atcctagcctcggtgctggcagtgtcccaacaggaatacctagacagtatgaagaaaaac
aaagtgcacagagacccacccccagacaagagttga

DBGET integrated database retrieval system