KEGG   Bos taurus (cow): 539417Help
Entry
539417            CDS       T01008                                 

Gene name
C1GALT1
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1 (EC:2.4.1.122)
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
bta  Bos taurus (cow)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    539417 (C1GALT1)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     539417 (C1GALT1)
Glycosyltransferases [BR:bta01003]
 Glycan extension
  Type 3 chain
   539417 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
4
AA seq 368 aa AA seqDB search
MASKSWLNILTFLCGSAVGFVLCSQLLSILFEEQKDIQPSILHNDPHARHSDDNEQNHLE
GQMNFDADASQHKDENTDIADKLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLKTREGRDQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLR
WLLSKYNPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVEAFKTDKCTHSSSIED
LALGRCMEIINVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPEKMLKEVSQIYKNEDTNVNQ
EPLKEKHK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaatattttaaccttcctttgtggatcagcagtcggattt
gttttatgctctcagctacttagtattttgttcgaagaacagaaggacatccagcctagt
attcttcataatgatcctcacgctaggcattcagatgacaatgaacagaatcatctagaa
ggacagatgaacttcgatgcagatgccagccaacataaagatgagaacactgacatcgct
gataagctctatcagaaggttaaaattctttgctgggtaatgacagggcctcaaaatcta
gagaaaaaggctaaacatgtcaaagccacatgggcccagcgttgtaataaagtgttgttt
atgagttcagaagaaaacaaggacttccctgctgtgggattaaaaaccagagaaggcaga
gaccaactgtactggaaaacaattaaagcctttcagtatgttcatgatcattatttagaa
gatgctgattggtttatgaaagcagatgatgatacttacgttatactagataacttgaga
tggcttctctcaaaatacaaccctgaagaacccatttactttgggagaagatttaagccc
tatgtaaagcagggctacatgagtggaggagcaggatatgtactgagcaaagaagctttg
aagagatttgttgaagcatttaaaacagacaaatgtacacacagttcctcaatcgaagat
ttagcactggggagatgcatggaaattataaatgtagaagcgggagattccagagacacc
actggaaaagaaacttttcatccttttgtaccagaacaccacttaatcaagggttatctg
ccgagaaccttttggtactggaattataactattatcctcctgtagagggtcctggttgc
tgttccgatcttgcagtttcttttcactatgttgatcctacaactatgtatgagttagaa
tacctcgtttatcatcttcgtccgtatggttatttatacagatatcaacctgccttacct
gagaagatgctaaaggaagtaagtcagatatacaaaaatgaagacacaaacgtaaatcag
gagcccttgaaagaaaaacataaatga

DBGET integrated database retrieval system