KEGG   Bos taurus (cow): 539561Help
Entry
539561            CDS       T01008                                 

Gene name
GLS2
Definition
glutaminase 2 (liver, mitochondrial) (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bta  Bos taurus (cow)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    539561 (GLS2)
   00330 Arginine and proline metabolism
    539561 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    539561 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    539561 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    539561 (GLS2)
   04727 GABAergic synapse
    539561 (GLS2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    539561 (GLS2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     539561 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
5
AA seq 574 aa AA seqDB search
MRSFKALQNSLSRAGSHCRRGGWGHLSQNPLLTDSSESGMLSRLGDLLFYTIGEGQERIP
IHKFTTALKATGLQTSDPRLRDCMSQMRRMVRQSNSGGLLDRDLFRKCVSSNIVLLTQAF
RKKFVIPDFEEFTSHVDRIFEDAKELTGGKVAAYIPQLAKSNPDLWGVSLCTVDGQRHSV
GHTKIPFCLQSCVKPLTYAISISTLGTDYVHKFVGKEPSGLRYNTLSLNEEGIPHNPMVN
AGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGNEYMGFSNATFQSEKETGDRNYAIGYYL
KEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRN
TLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNIMGMMCLSPPLDKLGNSYRGV
NFCQKLVSLFNFHNYDNLRHCARKLDPRREGGEVRNKTVVNLLFAASSGDVSALRRFALS
AMDMEQKDYDSRTALHVAAAEGHIEVVKFLIEACKVNPFVKDRWGNIPLDDAVQFNHLEV
VKLLQDYQDSYTPSETWAEAAAEALSKENLESMV
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccttcaaggctctacagaattcgctgagcagggctggcagtcactgccggcgg
ggaggctggggtcacctgagccagaaccctctccttactgactcttcagagagtggcatg
ctgtcccgtctgggtgacctgctcttctacactattggtgagggacaggaacgaatacct
atccacaagttcactactgcgctgaaggccaccggactgcagacgtcagatccccggctc
cgggactgcatgagccagatgcgccgcatggttcgacagtccaacagtggtggcctcttg
gaccgagatcttttccgaaagtgtgtgagcagcaacattgtgctactgactcaggccttc
cgaaagaagtttgttattcctgattttgaggagttcacgagccacgtggaccgcatcttt
gaggatgccaaagagctcactggaggcaaggtggcagcctacatccctcagctggccaag
tcaaatccagacctgtggggtgtctcgctgtgcactgtggatggtcaacgacactccgtg
ggccacacaaagatccccttctgcctgcagtcctgcgtgaagcccctcacgtatgccatc
tccataagcaccctaggcacagactacgtgcacaagttcgtgggcaaggagcccagcggc
ctgcgctacaacacgctctccctcaatgaggaaggaatcccccataaccccatggtcaat
gctggtgctattgtcgtgagctccctgatcaagatggactgtaacaaagcagaaaagttt
gattttgtcttgcaatatctgaacaaaatggctgggaatgaatacatgggtttcagcaat
gccacattccagtcagagaaggaaacgggggatcggaattatgccatcggttattatcta
aaggaaaagaagtgctttcctaaaggggtggacatgatggctgcccttgatctctacttc
cagctgtgctctgtggaggtgacctgtgaatcgggcagtgtcatggcagccaccctggcc
aatggtgggatctgccccatcactggagagagcgtgctgagcgcggaagccgtgcgcaac
accctcagcctcatgcactcctgcggcatgtacgacttctcgggccagtttgccttccat
gtgggcctgccggccaaatcagctgtgtcaggagccatcctcctggtggtacccaacatc
atggggatgatgtgtctatcacctccactggacaagctggggaacagctatagaggggtc
aacttctgccaaaagttggtgtctctcttcaatttccacaactatgataacctgaggcac
tgtgctcggaaattagacccacggcgtgaagggggagaagtccggaacaagactgtggtg
aacctcttatttgctgcctctagtggagatgtctcagctcttcgaaggtttgccttgtca
gccatggacatggaacagaaagactatgactcccgcaccgccctgcacgttgctgccgct
gaaggacacattgaagttgttaaattcctgattgaggcctgcaaagtgaatccttttgtc
aaggacaggtggggcaacatccccctggatgatgctgtgcagttcaaccacctggaggtg
gtgaaactgctccaagactaccaggactcatacacaccatctgagacttgggctgaagct
gcagctgaggccctgtccaaagagaacttagagagcatggtgtga

DBGET integrated database retrieval system